KEGG   Gallus gallus (chicken): 417981Help
Entry
417981            CDS       T01006                                 

Gene name
CYP2D6, CYP2D49, CYP2D6c
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    417981 (CYP2D6)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     417981 (CYP2D6)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP2 family
   417981 (CYP2D6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 502 aa AA seqDB search
MTLLLWLSSWSNISVLGVFLTVFTILVDFMKRRKKWSRYPPGPMPLPFVGTMPYVNYYNP
HLSFEKFRKKFGNIFSLQNCWTNVVVLNGYKTVKEALVNKSEDFADRPYMPVYEHLGYGH
KSEGLVLARYGHLWKELRKFTLTTLRNFGMGKKSLEERVTEEAGFLCSAISSEGGHPFDP
RFLVNNAVCNVICTITYGERFDYGDKTFKKLLTLFENSLNEEAGFLPQLLNVAPVLLRIP
GLPQKIFPCQKAYVDFTQMLIDKHKETWNPAYIRDFTDAFLKEMAKGKEAEENGFNKSNL
TLVTADLLVAGSETTATTLRWAFLFMLLYPEIQSKVHKEIDKVIGRNRPPTMADQVNMPY
TNAVIHEVQRFGDVVPMGLPHMTYRDTELQGFFIPKGTTIITNLTSVLKDETAWKKPNEF
YPEHFLNENGQFVRPEAFLPFSAGRRACLGEQLTRMELFIFFTTLMQKFTFVFPEDQPRP
REDSHFAFTNSPHPYQLRAVPR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacactgctcctgtggctgtcatcttggagcaacatctctgtactgggagtttttctt
actgtctttaccatacttgttgatttcatgaagcgcagaaagaagtggagccgttacccc
ccaggcccaatgccactgccgtttgttgggaccatgccatacgttaattactacaacccg
catctctccttcgagaagtttcgcaagaagtttggaaacattttcagtctccagaactgc
tggaccaatgtggtagtgctgaatgggtacaaaactgtgaaggaagccctggtcaacaaa
tcagaggactttgctgaccggccatacatgccagtatatgaacatctgggctatggacat
aaatctgaagggcttgttttggcaagatatggacatctctggaaagagctaaggaaattc
acgctcactaccctgaggaattttgggatgggaaagaagtccttggaagagcgagtgact
gaggaagcaggatttttgtgctctgcaatcagttctgaaggaggtcatccttttgatcca
cgttttcttgtaaataatgcagtctgcaatgtgatctgcaccattacctatggagagcgt
ttcgactatggagacaagacattcaagaagctgttaactttgtttgaaaactctctaaat
gaagaagctggattcctgcctcagcttcttaatgtggcacctgttttgttgcgcatccct
ggactgccacagaagatctttccgtgccaaaaggcatacgtagacttcacacaaatgctc
atagataagcacaaggagacctggaaccctgcttacatccgagacttcactgatgcattt
ttaaaggaaatggcaaagggtaaggaggctgaagagaatggtttcaataaaagcaacctt
actctggtgaccgcagacttacttgtagctggttctgagaccaccgccaccaccctccga
tgggcgttcctgttcatgcttttgtacccagaaatacaaagtaaagtccacaaagagatt
gataaggtgattggaagaaaccgaccgcccaccatggcagaccaagtgaacatgccctac
accaatgccgtcatccatgaagtacaacgctttggggacgttgttcctatgggactacct
cacatgacataccgggacactgagcttcaaggtttcttcattcccaaagggacgacaatc
atcaccaacttgacttcagtacttaaggatgagacggcctggaagaagccaaatgaattt
taccctgaacactttctgaatgagaatgggcaatttgtgagaccagaggccttcttgccc
ttctctgcaggtcgacgtgcctgcctgggggaacagctgaccaggatggagcttttcatc
ttcttcaccactctcatgcagaagttcacctttgtgttccctgaagatcagcccaggcca
cgagaggacagtcactttgcttttacaaacagtccacacccataccagttgcgagctgtt
ccaagataa

DBGET integrated database retrieval system