KEGG   Gallus gallus (chicken): 418000Help
Entry
418000            CDS       T01006                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:gga04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:gga04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:gga04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:gga04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:gga04110]
Cellular Processes; Cell communication; Adherens junction [PATH:gga04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:gga04916]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:gga05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 2446 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQSMAGQTPQNSPGMGMLNS
MVKSPMAQAGLTSPSMAMGTSGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGVMQGQVMNGSIGAGRGRPNMPYPNPGMGTAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKTGLQNSLPQFQMDKK
PVPGTGMPNMGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSISTTSQIDPSSIERAYAALG
LTYQGNQMQTQSQAQVKNQQQGQSPQGLRPMNPMSANPMGVNGGVGVQTPSLLPDSMLHS
TMNSQNSMMSESANVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPSAPGMPQAPVNQGPNMGQPQPGMSANGPITDPTLIRANVPNQMMNRMQAQPGMNQFG
HMNMQLSPMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQNPFPA
SSPGMNAASMPMTQTSNQTPVSQAQMNSSSCPVNSPAMAPGSQGSHIHCPPLPQPPMHRN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAATAVPTPTPQTVPPGPQSQTMHPPQRQTPTP
PQAQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDG
QVSNPPSTSSTEVNSQQTAAEQQQPPLQEVKMEIKTDEGEPEQTELQMEEKSEVTVEECK
PDPMEQEEKKTEVKTEMTEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPTLEALY
RQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFN
NAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIP
RDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVE
CIECGRKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFLENRV
NDFLKRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEI
DGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVK
KLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHDYKDI
FKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSKGDSK
NAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAA
NSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRF
VYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTATTQS
PGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLI
ALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQG
LPSPTPATPTTPTGQQPTTPQTPQPQPPPQPASQPQPAPPNSMPPYSMPRTQPPSAVSQG
KAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQMPQM
PPMGMNPPQIARGPGGHIDQGMGPAGIQQQPPWVQGGLPQAQLQPGMQRPSMMSVAQPGQ
PMNMAPQPGMGQVPGAAQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNPQLLA
AFIKQRAAKYAGSQNPQGMPGQPGMPQGQPGLQPQQAMQGQQGGVHPNAAMQNMNPMQGG
VQRPSMPQQQQPPQQPQQAMAGMNPQAQQMNMNHSGMAPQFRDLLMRRHQIMEQQRQQQQ
QGVGPALGPGMANHNQFQQPQGVGYPQQQQQQQQQQRMQHHMQQMQQGNMGQISQLPQAM
SAETGATLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQVR
SPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASPD
QSAMLSQLASNPGMAGLHGTSATELGLSSENSDLNSNLSQSTLDIH
NT seq 7341 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctcg
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactatttgatctggaa
catgacttgccagatgaactgatcagctccacagaactgggactcaccaatggaggtgac
attaatcagctgcagaccagccttggcctggcacaagatgctgcctctaaacacaagcag
ctgtcagaacttttacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccagagcatggccggccaaactccacaaaacagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaggctgggttgacttctcccagtatggcgatgggtaca
agtggaccaaatcagggtccttcagcccaatctacagcaggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacagggggtgatgcaggggcaagtcatgaacggttcg
attggagcgggcagagggcgaccaaatatgccatacccaaacccaggaatgggaactgct
ggtaacttgttggctgagacactgcagcaaggctctccgcagatggggggacaggctgga
ctgagggggccgcagcctggagccatgaacaagatgggaatgatgagcaatcccagtcct
tatggtcagccatatagtcagaatactgggcagcagattggagccagtggtctcggacct
cagatgcagaataaaactggactgcaaaatagcttaccgcagtttcaaatggacaagaag
ccagttcctgggacaggaatgcctaacatgggtcagcaacaagctccccaagttcaacaa
gctgggatggggccagcagcttcacaaggaatggggtctggagctccaacagcagatcca
gagaaacgcaaactcattcagcaacaactagttctcctcttacacgctcacaagtgtcaa
cggcgagaacaggccaatggtgaggtgcggcagtgcaacctccctcattgccgaaccatg
aagaatgtcctgaaccacatgacacattgtcaggctggcaaatcttgccaggtggcacat
tgtgcatcttctcgacaaatcatctcgcactggaagaactgtacaagacatgactgtcct
gtatgtttgccactcaaaaatgctggggacaaaagaaaccagcaatcgctactgggtgga
gctgcagtaggacttgcaaacaccggctccgtgggtgtggggcagcagactacgcccagc
ataagcactaccagccagatagaccccagctccatcgagagagcctatgcagcccttgga
ctaacctatcaagggaaccagatgcagacacagtctcaggctcaagtgaagaatcagcag
caaggacagtcaccccagggtctgcgcccaatgaatcctatgagtgcaaatccaatggga
gtaaatggaggagtaggagttcaaacccccagtctgctgcctgactcaatgttacattca
accatgaattcccaaaactccatgatgagtgaaagcgccaatgttgctagtctgggggct
atgccaacagctcagccatccaatacaggaattcgaaagcagtggcatgaagatattact
caggatcttcgaaatcatcttgttcataaattagtccaagccatatttcctacacctgac
cctgcagcattgaaggatcggcgtatggagaatctggtggcatatgctcggaaagtggaa
ggcgatatgtatgaatcagcaaatagcagggcagagtattatcacttgctagctgagaag
atctataagattcagaaggagctggaggaaaagcgaagaaccaggctgcagaagcaaaac
atgataccaagtgctccaggcatgccacaggctcctgtgaatcaagggcccaacatggga
cagcctcagccagggatgtctgcaaatggtcctataactgacccaacactgatacgtgcg
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cacatgaacatgcagctgtcaccgatgggaccccggcaaacccctcctcttcagcaccct
ggacagctaagccaggccggggccatgaaccagatgggatttccttcacgtatgcaacaa
ccaggagttggccaaccttctggtcaaaatcagtttctgcagcagaacccattccctgct
tcttccccaggaatgaatgcagcaagcatgcctatgacacaaactagcaatcagacacca
gtttctcaagcacaaatgaacagctcttcctgtcctgtgaattctcctgccatggctcca
ggttctcaaggaagccatattcactgcccacctcttccacagcctcccatgcaccgaaat
tctccttctccagtacctagtcgaaccccaacacctcaccatacacccccaggcttggga
tcgcagcaacagcaggcagcagcagctgccaccgctgttcccacccctactcctcagaca
gtgccacccggaccacagtcacaaactatgcatcccccgcagaggcagactccaacacct
ccgcaggcacagctgcctccacaagtccagcctccagttccagttaccccctctgcagag
cagcaacagcaacccttgtcacagcagagtacaacagcatcagttcccacaccaacagca
ccactgcagcctcagcaccccacaacacctttgtcacaaccagctgtaagcattgatggg
caggtgtccaacccaccatccaccagcagcacagaagtgaactctcagcagactgcagca
gagcagcagcagccacctttgcaggaagtgaaaatggagataaaaacagatgaaggggaa
ccagaacaaacagagctgcagatggaggagaaatctgaggtgacagtggaggaatgtaaa
ccagacccaatggaacaagaagagaagaaaacagaagtgaagactgaaatgacagaaggg
gaagaaagacctacaactccagctactcagtcttcaccagcagcaggacagtctaagaaa
aaaattttcaagccagaagagttgcggcaggcacttatgccaacactggaggcactttac
cgtcaggacccagagtctcttccatttcggcagcctgtggatccccagctactaggaatt
cctgattattttgacatagtgaagaatcccatggacctttctactatcaagaggaagtta
gacacagggcaatatcaagaaccatggcaatatgtagatgacatctggctcatgttcaat
aatgcctggctctacaaccgcaaaacatcccgggtatataagtactgctcaaaactggcc
gaggtgtttgagcaagaaattgacccagttatgcagagccttggttactgctgtggaaga
aagttggagttctcgccacagactttgtgttgctatggcaaacagctatgcacaatccct
cgagatgccacttactacagttaccagaacaggtatcatttctgtgagaagtgcttcaat
gaaatccaaggggagagcgtttctctgggagatgacccttcacaacctcaaaccacgata
aacaaagaacagttttcaaaaaggaaaaatgatacactggatcctgaactatttgttgaa
tgtatagaatgtggaagaaaaatgcaccagatctgtgttcttcacaatgagatcatctgg
ccttctggctttgtctgcgatggctgcctgaagaaaacaggacgaaccaggaaagagaac
aaattctctgctaaaaggttaccggctacaagacttggtaccttcttagagaacagagtc
aatgacttcctaaagcggcagaatcacccggaagcaggagaggttacagttagggtggta
catgcatctgacaaaactgtcgaagtaaagccaggaatgaaagcaagatttgtagacagt
ggagagatggctgagtctttcccctatcgaacaaaagcgctttttgcctttgaggagatt
gatggtgtagacttgtgcttctttgggatgcatgtgcaggagtatggctcagactgtccc
ccacccaatcaaaggcgagtgtatatatcttaccttgacagtgttcatttcttccgccct
aaatgcttgaggactgctgtctatcatgaaatcctaattggatatctagaatatgtcaag
aaattagggtatactactggacatatctgggcatgcccaccaagtgaaggagatgactac
attttccattgccatcctcctgaccaaaagatacccaaacccaaacgactgcaagagtgg
tacaaaaagatgctggacaaatctgtgtcagagcgcattgttcacgactacaaggatata
tttaagcaggcaacagaagaccgtctgacaagtgcaaaagagttgccttactttgaaggg
gacttctggccaaatgttctggaggagagtattaaggaactcgagcaagaggaggaagaa
cggaagagagaagagaacactagtaatgaaagcacggatgtgagcaaaggagacagcaaa
aatgccaaaaagaagaataataagaagacaagtaagaacaagagcagtttgagtcgtggc
aataagaagaagcctggcatgccgaatgtgtccaatgacctttcccaaaagctgtatgcc
actatggagaagcacaaagaggttttctttgtcatccgtctcattgctggccctgcagcc
aactcccttccccccatcgttgagcctgacccactcattccatgcgacctgatggatggg
cgcgatgctttccttacccttgctagagacaagcacctggagttctcctcactacgaagg
gctcagtggtcaaccatgtgcatgctggtggagctgcacacgcagagccaagaccgcttt
gtttacacctgcaacgagtgcaagcatcatgtggagaccagatggcactgcactgtgtgt
gaggattatgacctgtgcatcacctgctataacactaaaaatcatgaccataagatggag
aaattaggcctcggtctagatgatgagagcaacaaccagcagactgcaaccacccagagc
ccaggtgactcccgccgcctgagcatccagcgctgcatccagtccctggtccacgcctgc
cagtgccgtaacgccaactgctcgctgccatcctgccagaagatgaaacgggttgtccaa
cacaccaaaggctgcaaacgcaaaaccaacggagggtgccccatctgcaagcaactcatt
gctctttgctgctaccatgcaaagcactgccaggagaacaagtgcccggtgcccttctgc
ctcaacatcaaacacaagcttcgtcaacagcagcttcagcaccgcctgcaacaggctcag
atgctccgaaggaggatggcaagtatgcagcggaccggtgtggtgggccagcagcagggg
ttgccctcaccgacaccggccaccccgacaactccaacaggccagcaacccacgacgcca
caaactcctcagccccagcctccgccccagcctgcctcgcagcctcagcctgcgcctccc
aacagcatgccaccctacagcatgccgagaactcagccccccagcgctgtgtcccagggc
aaggcaggtggccaggtgactcctccaactccaccccagccgcctcagccaccagttcag
ggtcctcctccagcagcggtggaaatggccatgcagatccagagggcagcggagacccaa
cgacagatggcgcaggttcagattttccaaaggccgattcagcaccagatgccccagatg
ccgcccatgggaatgaatcctccgcagatagccaggggtcctggtggtcacatagatcaa
ggaatggggccggcggggatccagcagcagccgccttgggtgcagggtggcttgcctcaa
gctcaactgcagccggggatgcagaggccatccatgatgtcagtagcccagccaggtcag
ccgatgaatatggcacctcagccaggaatgggccaggtacctggcgctgctcagccaaaa
cagccacctctgccccaggcggccttacagaacctactgcggacactcaggtctcccagc
tcacccatgcagcagcagcaggtgcttaacatccttcactccaatcctcagctgctggct
gctttcatcaagcagcgggccgccaagtacgcggggtcccaaaacccccaggggatgcct
ggtcagcctggcatgccccagggccagccggggctccaaccgcagcaggccatgcagggg
cagcagggaggggtgcaccccaacgcagccatgcagaacatgaaccccatgcagggaggg
gtgcagaggcccagcatgccacagcagcagcagccgccacagcagccacagcaagccatg
gctgggatgaatcctcaggcacagcagatgaatatgaatcactcggggatggctcctcag
ttccgagacctcctgatgcggcggcaccagataatggagcagcagcgccagcagcagcag
caaggagtgggaccggcgctggggccagggatggccaaccacaaccagttccagcagccc
cagggcgtcgggtatccgcagcagcagcagcaacagcagcagcagcaacggatgcagcat
cacatgcagcagatgcagcaaggaaacatgggacagataagccagcttccccaggccatg
agtgcagagacaggagccactttgcagcaggctttccagcagaggctgctccagcagcag
atggggtccccggctcagcccaatcctatgagcccccagcagcacatgctgcccaaccag
gcccagtccccacacctacagggccagcagctcccttcgtcgctcaccaatcaagtgcgc
tctccgcagcctgtaccctcgccacggccccagtcccagcccccccattccagcccgtcc
ccccggatgcagcctcagccttctccgcaccacgtctccccgcagaccagctccccacat
ccaggactggtagctgcccaggctaaccccatggatcaagggcactttgccagcccggac
cagagtgcaatgctttcccagcttgctagcaatcctggtatggcaggcctccatggtaca
agcgccacggaactggggctcagctctgagaactcagacttgaattcaaatctttcacag
agtacactagacatacactag

DBGET integrated database retrieval system