KEGG   Gallus gallus (chicken): 418000Help
Entry
418000            CDS       T01006                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    418000 (EP300)
   04330 Notch signaling pathway
    418000 (EP300)
   04350 TGF-beta signaling pathway
    418000 (EP300)
   04068 FoxO signaling pathway
    418000 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    418000 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    418000 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    418000 (EP300)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    418000 (EP300)
   05168 Herpes simplex infection
    418000 (EP300)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     418000 (EP300)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    418000 (EP300)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    418000 (EP300)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    418000 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 2450 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQSMAGQTPQNSPGMGMLNS
MVKSPMAQAGLTSPSMAMGTSGPNQGPSAQSTAGMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGVMQGQVMNGSIGAGRGRPNMPYPNPGMGTAGNLLAETLQQGSPQMGGQAG
LRGPQPGAMNKMGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKTGLQNSLPQFQMDKK
PVPGTGMPNMGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSISTTSQIDPSSIERAYAALG
LTYQGNQMQTQSQAQVKNQQQGQSPQGLRPMNPMSANPMGVNGGVGVQTPSLLPDSMLHS
TMNSQNSMMSESANVASLGAMPTAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPSAPGMPQAPVNQGPNMGQPQPGMSANGPITDPTLIRANVPNQMMNRMQAQPGMNQFG
HMNMQLSPMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQNPFPA
SSPGMNAASMPMTQTSNQTPVSQAQMNSSSCPVNSPAMAPGSQGSHIHCPPLPQPPMHRN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAATAVPTPTPQTVPPGPQSQTMHPPQRQTPTP
PQAQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSIDG
QVSNPPSTSSTEVNSQQTAAEQQQPPLQEVKMEIKTDEGEPEQTELQMEEKSEVKVEPAV
EECKPDPMEQEEKKTEVKTEMTEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPTL
EALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIW
LMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQL
CTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPE
LFVECIECGRKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTFL
ENRVNDFLKRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFA
FEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYL
EYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVHD
YKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVSK
GDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIA
GPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQS
QDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQTA
TTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPIC
KQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVVG
QQQGLPSPTPATPTTPTGQQPTTPQTPQPQPPPQPASQPQPAPPNSMPPYSMPRTQPPSA
VSQGKAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQHQ
MPQMPPMGMNPPQIARGPGGHIDQGMGPAGIQQQPPWVQGGLPQAQLQPGMQRPSMMSVA
QPGQPMNMAPQPGMGQVPGAAQPKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSNP
QLLAAFIKQRAAKYAGSQNPQGMPGQPGMPQGQPGLQPQQAMQGQQGGVHPNAAMQNMNP
MQGGVQRPSMPQQQQPPQQPQQAMAGMNPQAQQMNMNHSGMAPQFRDLLMRRHQIMEQQR
QQQQQGVGPALGPGMANHNQFQQPQGVGYPQQQQQQQQQQRMQHHMQQMQQGNMGQISQL
PQAMSAETGATLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLT
NQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHF
ASPDQSAMLSQLASNPGMAGLHGTSATELGLSSENSDLNSNLSQSTLDIH
NT seq 7353 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctcg
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactatttgatctggaa
catgacttgccagatgaactgatcagctccacagaactgggactcaccaatggaggtgac
attaatcagctgcagaccagccttggcctggcacaagatgctgcctctaaacacaagcag
ctgtcagaacttttacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccagagcatggccggccaaactccacaaaacagtcctggaatgggaatgttaaacagc
atggtgaaaagccccatggcacaggctgggttgacttctcccagtatggcgatgggtaca
agtggaccaaatcagggtccttcagcccaatctacagcaggaatgatgccaacagtaaac
agtccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaatggacagggggtgatgcaggggcaagtcatgaacggttcg
attggagcgggcagagggcgaccaaatatgccatacccaaacccaggaatgggaactgct
ggtaacttgttggctgagacactgcagcaaggctctccgcagatggggggacaggctgga
ctgagggggccgcagcctggagccatgaacaagatgggaatgatgagcaatcccagtcct
tatggtcagccatatagtcagaatactgggcagcagattggagccagtggtctcggacct
cagatgcagaataaaactggactgcaaaatagcttaccgcagtttcaaatggacaagaag
ccagttcctgggacaggaatgcctaacatgggtcagcaacaagctccccaagttcaacaa
gctgggatggggccagcagcttcacaaggaatggggtctggagctccaacagcagatcca
gagaaacgcaaactcattcagcaacaactagttctcctcttacacgctcacaagtgtcaa
cggcgagaacaggccaatggtgaggtgcggcagtgcaacctccctcattgccgaaccatg
aagaatgtcctgaaccacatgacacattgtcaggctggcaaatcttgccaggtggcacat
tgtgcatcttctcgacaaatcatctcgcactggaagaactgtacaagacatgactgtcct
gtatgtttgccactcaaaaatgctggggacaaaagaaaccagcaatcgctactgggtgga
gctgcagtaggacttgcaaacaccggctccgtgggtgtggggcagcagactacgcccagc
ataagcactaccagccagatagaccccagctccatcgagagagcctatgcagcccttgga
ctaacctatcaagggaaccagatgcagacacagtctcaggctcaagtgaagaatcagcag
caaggacagtcaccccagggtctgcgcccaatgaatcctatgagtgcaaatccaatggga
gtaaatggaggagtaggagttcaaacccccagtctgctgcctgactcaatgttacattca
accatgaattcccaaaactccatgatgagtgaaagcgccaatgttgctagtctgggggct
atgccaacagctcagccatccaatacaggaattcgaaagcagtggcatgaagatattact
caggatcttcgaaatcatcttgttcataaattagtccaagccatatttcctacacctgac
cctgcagcattgaaggatcggcgtatggagaatctggtggcatatgctcggaaagtggaa
ggcgatatgtatgaatcagcaaatagcagggcagagtattatcacttgctagctgagaag
atctataagattcagaaggagctggaggaaaagcgaagaaccaggctgcagaagcaaaac
atgataccaagtgctccaggcatgccacaggctcctgtgaatcaagggcccaacatggga
cagcctcagccagggatgtctgcaaatggtcctataactgacccaacactgatacgtgcg
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cacatgaacatgcagctgtcaccgatgggaccccggcaaacccctcctcttcagcaccct
ggacagctaagccaggccggggccatgaaccagatgggatttccttcacgtatgcaacaa
ccaggagttggccaaccttctggtcaaaatcagtttctgcagcagaacccattccctgct
tcttccccaggaatgaatgcagcaagcatgcctatgacacaaactagcaatcagacacca
gtttctcaagcacaaatgaacagctcttcctgtcctgtgaattctcctgccatggctcca
ggttctcaaggaagccatattcactgcccacctcttccacagcctcccatgcaccgaaat
tctccttctccagtacctagtcgaaccccaacacctcaccatacacccccaggcttggga
tcgcagcaacagcaggcagcagcagctgccaccgctgttcccacccctactcctcagaca
gtgccacccggaccacagtcacaaactatgcatcccccgcagaggcagactccaacacct
ccgcaggcacagctgcctccacaagtccagcctccagttccagttaccccctctgcagag
cagcaacagcaacccttgtcacagcagagtacaacagcatcagttcccacaccaacagca
ccactgcagcctcagcaccccacaacacctttgtcacaaccagctgtaagcattgatggg
caggtgtccaacccaccatccaccagcagcacagaagtgaactctcagcagactgcagca
gagcagcagcagccacctttgcaggaagtgaaaatggagataaaaacagatgaaggggaa
ccagaacaaacagagctgcagatggaggagaaatctgaggttaaagtagaaccagcagtg
gaggaatgtaaaccagacccaatggaacaagaagagaagaaaacagaagtgaagactgaa
atgacagaaggggaagaaagacctacaactccagctactcagtcttcaccagcagcagga
cagtctaagaaaaaaattttcaagccagaagagttgcggcaggcacttatgccaacactg
gaggcactttaccgtcaggacccagagtctcttccatttcggcagcctgtggatccccag
ctactaggaattcctgattattttgacatagtgaagaatcccatggacctttctactatc
aagaggaagttagacacagggcaatatcaagaaccatggcaatatgtagatgacatctgg
ctcatgttcaataatgcctggctctacaaccgcaaaacatcccgggtatataagtactgc
tcaaaactggccgaggtgtttgagcaagaaattgacccagttatgcagagccttggttac
tgctgtggaagaaagttggagttctcgccacagactttgtgttgctatggcaaacagcta
tgcacaatccctcgagatgccacttactacagttaccagaacaggtatcatttctgtgag
aagtgcttcaatgaaatccaaggggagagcgtttctctgggagatgacccttcacaacct
caaaccacgataaacaaagaacagttttcaaaaaggaaaaatgatacactggatcctgaa
ctatttgttgaatgtatagaatgtggaagaaaaatgcaccagatctgtgttcttcacaat
gagatcatctggccttctggctttgtctgcgatggctgcctgaagaaaacaggacgaacc
aggaaagagaacaaattctctgctaaaaggttaccggctacaagacttggtaccttctta
gagaacagagtcaatgacttcctaaagcggcagaatcacccggaagcaggagaggttaca
gttagggtggtacatgcatctgacaaaactgtcgaagtaaagccaggaatgaaagcaaga
tttgtagacagtggagagatggctgagtctttcccctatcgaacaaaagcgctttttgcc
tttgaggagattgatggtgtagacttgtgcttctttgggatgcatgtgcaggagtatggc
tcagactgtcccccacccaatcaaaggcgagtgtatatatcttaccttgacagtgttcat
ttcttccgccctaaatgcttgaggactgctgtctatcatgaaatcctaattggatatcta
gaatatgtcaagaaattagggtatactactggacatatctgggcatgcccaccaagtgaa
ggagatgactacattttccattgccatcctcctgaccaaaagatacccaaacccaaacga
ctgcaagagtggtacaaaaagatgctggacaaatctgtgtcagagcgcattgttcacgac
tacaaggatatatttaagcaggcaacagaagaccgtctgacaagtgcaaaagagctgcct
tactttgaaggtgatttctggcccaacgtgctggaggagagtattaaggaactcgagcaa
gaggaggaagaacggaagagagaagagaacactagtaatgaaagcacggatgtgagcaaa
ggagacagcaaaaatgccaaaaagaagaataataagaagacaagtaagaacaagagcagt
ttgagtcgtggcaataagaagaagcctggcatgccgaatgtgtccaatgacctttcccaa
aagctgtatgccactatggagaagcacaaagaggttttctttgtcatccgtctcattgct
ggccctgcagccaactcccttccccccatcgttgagcctgacccactcattccatgcgac
ctgatggatgggcgcgatgctttccttacccttgctagagacaagcacctggagttctcc
tcactacgaagggctcagtggtcaaccatgtgcatgctggtggagctgcacacgcagagc
caagaccgctttgtttacacctgcaacgagtgcaagcatcatgtggagaccagatggcac
tgcactgtgtgtgaggattatgacctgtgcatcacctgctataacactaaaaatcatgac
cataagatggagaaattaggcctcggtctagatgatgagagcaacaaccagcagactgca
accacccagagcccaggtgactcccgccgcctgagcatccagcgctgcatccagtccctg
gtccacgcctgccagtgccgtaacgccaactgctcgctgccatcctgccagaagatgaaa
cgggttgtccaacacaccaaaggctgcaaacgcaaaaccaacggagggtgccccatctgc
aagcaactcattgctctttgctgctaccatgcaaagcactgccaggagaacaagtgcccg
gtgcccttctgcctcaacatcaaacacaagcttcgtcaacagcagcttcagcaccgcctg
caacaggctcagatgctccgaaggaggatggcaagtatgcagcggaccggtgtggtgggc
cagcagcaggggttgccctcaccgacaccggccaccccgacaactccaacaggccagcaa
cccacgacgccacaaactcctcagccccagcctccgccccagcctgcctcgcagcctcag
cctgcgcctcccaacagcatgccaccctacagcatgccgagaactcagccccccagcgct
gtgtcccagggcaaggcaggtggccaggtgactcctccaactccaccccagccgcctcag
ccaccagttcagggtcctcctccagcagcggtggaaatggccatgcagatccagagggca
gcggagacccaacgacagatggcgcaggttcagattttccaaaggccgattcagcaccag
atgccccagatgccgcccatgggaatgaatcctccgcagatagccaggggtcctggtggt
cacatagatcaaggaatggggccggcggggatccagcagcagccgccttgggtgcagggt
ggcttgcctcaagctcaactgcagccggggatgcagaggccatccatgatgtcagtagcc
cagccaggtcagccgatgaatatggcacctcagccaggaatgggccaggtacctggcgct
gctcagccaaaacagccacctctgccccaggcggccttacagaacctactgcggacactc
aggtctcccagctcacccatgcagcagcagcaggtgcttaacatccttcactccaatcct
cagctgctggctgctttcatcaagcagcgggccgccaagtacgcggggtcccaaaacccc
caggggatgcctggtcagcctggcatgccccagggccagccggggctccaaccgcagcag
gccatgcaggggcagcagggaggggtgcaccccaacgcagccatgcagaacatgaacccc
atgcagggaggggtgcagaggcccagcatgccacagcagcagcagccgccacagcagcca
cagcaagccatggctgggatgaatcctcaggcacagcagatgaatatgaatcactcgggg
atggctcctcagttccgagacctcctgatgcggcggcaccagataatggagcagcagcgc
cagcagcagcagcaaggagtgggaccggcgctggggccagggatggccaaccacaaccag
ttccagcagccccagggcgtcgggtatccgcagcagcagcagcaacagcagcagcagcaa
cggatgcagcatcacatgcagcagatgcagcaaggaaacatgggacagataagccagctt
ccccaggccatgagtgcagagacaggagccactttgcagcaggctttccagcagaggctg
ctccagcagcagatggggtccccggctcagcccaatcctatgagcccccagcagcacatg
ctgcccaaccaggcccagtccccacacctacagggccagcagctcccttcgtcgctcacc
aatcaagtgcgctctccgcagcctgtaccctcgccacggccccagtcccagcccccccat
tccagcccgtccccccggatgcagcctcagccttctccgcaccacgtctccccgcagacc
agctccccacatccaggactggtagctgcccaggctaaccccatggatcaagggcacttt
gccagcccggaccagagtgcaatgctttcccagcttgctagcaatcctggtatggcaggc
ctccatggtacaagcgccacggaactggggctcagctctgagaactcagacttgaattca
aatctttcacagagtacactagacatacactag

DBGET integrated database retrieval system