KEGG   Gallus gallus (chicken): 418023Help
Entry
418023            CDS       T01006                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 203 aa AA seqDB search
MSCVPWKGDKAKSESPEPPQLLPPLHIYHEKQRRELCALHALNNVFQDSNAFTRETLQEI
FQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFI
MNLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRG
KNCELLLVVPEEVEAHQSWRADV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggtgacaaggccaaatcggagtccccagagccaccccag
ctgctgccgccgctacatatttaccacgagaagcagcgcagggagttgtgtgccctccat
gccctcaacaatgtcttccaggacagcaacgccttcactagggaaaccctgcaggagatt
tttcagaggctgtctcccaacaccatggtgacgccacacaagaagagcatgctgggaaat
gggaactatgatgtgaacgtgatcatggcagcgcttcagaccaaaggatatgaggcagtt
tggtgggacaagcgcagggatgttaatgtcattgccctgtctaatgtgatgggcttcatc
atgaatctgccgtccagcctttgctggggtcccttgaagctccccctcaagcggcagcac
tggatctgcgtccgggaggtgggaggcacttactataacctcgactccaaactcaagatg
cctgagtggattggaggtgaaagtgagctcaggaaatttttgaaacaccagctaagagga
aagaactgtgaactcctgctggtggtgccagaggaggtggaagcacatcagagctggaga
gctgacgtgtga

DBGET integrated database retrieval system