KEGG   Gallus gallus (chicken): 418044Help
Entry
418044            CDS       T01006                                 

Gene name
RAC2
Definition
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:gga04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:gga04370]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
Cellular Processes; Cell communication; Adherens junction [PATH:gga04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRTKKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcaagtgtgtcgtggtgggagatggagctgtgggaaaaacctgtctcctt
atcagctataccactaatgccttcccaggagaatacatccccactgtgtttgataactat
tctgccaacgtgatggttgacagcaagcctgtaaatctggggctttgggatactgctgga
caagaggattacgacaggctgaggccactctcttacccacagacggatgtcttcctgatc
tgcttctcccttgtcagcccagcatcttatgaaaacgtccgtgctaagtggttccccgag
gtgcggcaccattgccccagcactcccatcatccttgtgggcacaaagctggatcttcgt
gatgacaaagacaccattgagaagctgaaggagaagaagctttctcctattacatatcct
cagggtcttgccttggccaaggaaattgactctgtgaagtacctcgaatgctcggcgttg
acgcagcgtggcctgaagacggtgtttgatgaggccatccgagcagtcctctgcccacag
cccacccgaacgaagaaacgagcatgcagcctcctctag

DBGET integrated database retrieval system