KEGG   Gallus gallus (chicken): 418078Help
Entry
418078            CDS       T01006                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
gga  Gallus gallus (chicken)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    418078 (ALDH1L2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     418078 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 922 aa AA seqDB search
MLRAAPRLLRTFCTSSAAYQHKLKLALIGQSIFGQEVYNKLRKEGHKVVGVFTVPDKNGQ
ADPLALAAEKDGTPVFKFPRWRAKGKPIQEVIAAYKSVGAELNVLPFCTQFIPMDVIDCP
KHGSIIYHPSILPRHRGASAINWTLIQGDKKAGFTIFWADDGLDTGPILLQRECDVGQND
TVDDLYNRFLFPEGVKAMVEAVHLIADGKAPRIPQPKEGATYEGIQKKENAEISWDQPAA
ALHNWIRGHDKVPGAWATIDDQVVTFYGSSLLDASVPAGQELAIRGASRPGLVTKNGLVI
FGNDGKMVLVRNLQFQDGKMIPASKYFSADETTTLELTEEEKKMAEDIKAIWKGILSNVP
VIEDSTDFFKSGASSMHVVRMLEEIKQKYSGLQLQNEDVYMATKFADFIQMAVRKLRGEN
GEEELVIDYVSKNVNNMTVNMPYQCFINGQFVNADDGKTYDTINPTDGSVIASVSSASLA
DVDRAVAAAKEAFENGEWGRMNARERGRLMYKLADLMEEHQEELATIESIDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGATIPINQARPNHNLTFTKKEPIGVCAIVIPWNYPLMM
LAWKSAACLAAGNTLVLKTAQVTPLTALKFAELSAKAGFPKGVINILPGSGGLVGQHLSK
HPDVRKVGFTGSTPTGKEIMKSAATNLKKVSLELGGKSPLIIFNDCELDKAVKMGMGAVY
FNKGENCIAAGRLFVEESIHDEFVRKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLK
YCETGVKEGATLVYGGRQVRRPGYFMEPTVFTDVEDHMYIAQEESFGPVMVISKFKNGDI
DGVLQRANTTEYGLASGVFTKDISKALYISEKLEAGTVFINTYNKTDVAAPFGGFKQSGF
GKDLGEEALHEYLRTKAVTVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggcagccccgcgcctgttgcggaccttctgcacgagctccgcggcataccag
cataagctaaagctagcccttattggtcaaagcatttttggacaagaagtttataacaag
ctcaggaaagagggccataaagttgtgggagttttcacagtgcctgacaagaatggacaa
gctgatcctttggcactggcagcagagaaggatggcactcctgtttttaaatttcccaga
tggagagctaaaggcaagcctatccaggaagtaattgcagcctacaaatcagttggagca
gagctcaatgtccttccattctgtacacagttcatcccaatggatgtcattgactgccca
aaacatggctcaattatttaccatccatccatcctaccacgccaccgaggagcttctgca
atcaactggactttaattcaaggagataagaaagcaggatttacaattttttgggctgat
gatggtttggacactggacccatacttctgcagcgagaatgtgatgttggccaaaatgat
actgtggatgatctgtataaccggtttctcttcccagaaggagtaaaggctatggtggaa
gctgtgcatctaattgctgatggtaaggcgcctcgtatacctcagccgaaagaaggggca
acatacgaagggatccagaaaaaggaaaatgcagagatctcctgggatcaacctgcagca
gctttgcacaactggatccgagggcatgataaagtacctggagcatgggcaacaatagat
gaccaggtggtcactttttatggctcatcactgcttgatgcttcagtgcctgctggacaa
gagctggcaataagaggtgcttcaagacctggacttgtaaccaagaatggtctagtcatt
tttggtaatgacgggaagatggtactagtgagaaatctgcagtttcaggatggaaaaatg
atccctgcttctaaatacttctctgctgatgaaacaactaccctggaacttacagaagag
gagaaaaagatggcagaagatattaaggctatttggaaaggaattttgagcaatgttcct
gtaatagaagattccacagacttcttcaaatctggagcatcctctatgcatgttgtcaga
atgctagaagagatcaaacagaaatacagtgggcttcagcttcagaatgaagatgtatat
atggccactaagtttgcagactttattcaaatggctgtcagaaaactcagaggagagaat
ggggaagaagagttggtcattgattacgtttcaaaaaatgtgaacaatatgactgtgaat
atgccataccagtgtttcattaacggtcaatttgtcaatgctgatgatggaaaaacatat
gataccataaatccaacagatggatcagtaattgccagtgtatcttctgcttccttggct
gacgttgacagagcagtggcagcagcaaaagaggcatttgaaaatggtgaatggggaaga
atgaatgcaagggaaagagggcgactcatgtacaagcttgcagacctaatggaagaacat
caagaagagttagcaactatagagtctatcgattcaggagccgtctacactttagctttg
aagacccacattggaatgtccgtacaaactttcagatactttgctggatggtgtgacaag
attcagggtgctacaattccaattaaccaggcccggccaaaccataatctaacattcacc
aagaaagagccaataggtgtctgtgcaattgttatcccttggaattacccactgatgatg
cttgcatggaagagtgcagcatgcttggctgcaggcaacacactggttctcaagacagct
caggtcacacctctgactgccttgaagtttgcagaactctcagctaaagctggatttcct
aagggtgttataaatatactgcctggttcaggtggcttagtgggacagcacttgtctaaa
catccagatgttcgcaaagttggcttcactggttctacaccgactggtaaagagatcatg
aaaagtgcagccactaatctgaagaaagtttctcttgaacttggcggtaaatcaccattg
atcatattcaatgactgtgaacttgacaaagctgtaaaaatgggtatgggagcagtatat
ttcaacaaaggtgaaaactgcattgctgctggcaggctgtttgtggaggagtcaatacat
gacgaatttgttagaaaagtggtggaagaaataaaaaagatgaaaatcggtgacccactt
gatagatcaacagatcatggcccacagaatcacaaagctcatctggaaaagctgctgaag
tattgtgaaactggagtaaaagaaggagccactctagtgtatggaggaagacaagtacgt
agaccaggttacttcatggaacccactgtattcacagatgttgaagaccatatgtatatt
gctcaggaagaatcctttggtcctgtgatggtgatttccaaatttaaaaatggggatatc
gatggagtgctgcaacgggcaaacaccacagaatatggtctagcttcaggagttttcaca
aaggacataagcaaagctctctatatcagtgaaaagctggaagccggaacagtttttatt
aatacatacaacaaaactgacgtggcagcaccatttggtggatttaaacagtctggcttt
ggaaaagatttaggtgaagaagctcttcatgaatatcttagaacaaaggctgtcactgtg
gaatattaa

DBGET integrated database retrieval system