KEGG   Gallus gallus (chicken): 418167Help
Entry
418167            CDS       T01006                                 

Gene name
USP18, USP41
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
1
AA seq 427 aa AA seqDB search
MRPRGKAEGRPWLRELEVPREPVGNLIDCLSLRRAAAAGLCPSVIVHAMLLMSHRGGHQE
SKKKLEISPSETMKAEEENYKEEAKEPKSEDWRSPSVFGAADLKNRAVGLYNIGQTCCLN
SLLQVFLMNIHFTKILRRISVPVCATQKKKNVPYQMLLLLEKMQCGKQKAVSPRELVLCL
EAHRVTMFVQYDAAQLFLTLWNLLKKQMKNPELVEKLSDLYTISVQEHLACQICSSETKR
NSSMLSLPVPLLDSDSSMLKTLEKCLQCFFRPEELTGHNMCFCEHCGKKTPFQQSVKLVH
LPQTLTIHLKRFCFGRSAYIHKISNCLPFPQDLDFNAVLTEQQCQAYDNEKAAWKYELFA
VVAHSGTTSYGHYCAYIRSLTECKWYCFNDSFVEQVSWDDVKSTYGHSDLYWGQTAYLLF
YMKKQPQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccgggggaaagctgaaggccggccgtggctccgagagctcgaggtcccgcgg
gaaccggtaggaaaccttatcgactgtttgtcattacggagagccgcagccgcagggctc
tgtccttctgtgattgtacatgcaatgctattgatgagccatagaggtgggcatcaagaa
agcaagaagaaactagagatatcaccaagtgagaccatgaaggcagaagaagaaaattat
aaagaggaagccaaagagccaaagagcgaagactggaggtcaccatcagtcttcggcgct
gcagacttaaaaaatagagctgttggattgtacaacattggacagacctgctgtctgaac
tccctgctccaagtgttccttatgaacatacacttcacaaagatactgcgaaggatctca
gtgccagtgtgtgctacacaaaagaagaagaatgtcccataccaaatgcttttgctgctg
gagaagatgcagtgtggaaagcagaaagcagtttctcccagagagcttgttctctgtctt
gaagcacacagagtgacaatgtttgtacagtatgatgctgcccaactctttctgactctt
tggaacttgttaaagaagcagatgaaaaacccagagctggttgaaaagctgagtgatctg
tacaccatcagtgtgcaggagcacctggcctgtcagatatgctcttctgaaacaaagagg
aacagtagcatgttaagccttccggtcccattactggattctgactcttccatgctgaag
actctggagaagtgcctgcagtgctttttccgtccagaagagttgactggtcacaacatg
tgtttctgtgaacactgtggaaagaaaacaccttttcagcaaagtgtgaagctagtccac
ctgccacagactctgaccatacacctaaagcgcttctgctttggaagatcagcttacatc
cacaaaattagcaactgtctgccattcccacaagaccttgatttcaacgcagtcttgaca
gaacagcagtgccaagcgtatgacaatgaaaaggctgcctggaagtatgagctttttgct
gttgttgctcattcaggaacaactagctacggacattactgtgcctatattcgaagtctc
acagaatgcaaatggtattgcttcaacgattcttttgttgagcaggtgtcgtgggatgat
gttaaaagtacctatgggcattcagacctctactggggacaaacagcatatctcttgttt
tacatgaaaaaacagccccaatag

DBGET integrated database retrieval system