KEGG   Gallus gallus (chicken): 418182Help
Entry
418182            CDS       T01006                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:gga00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:gga04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:gga04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:gga04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 637 aa AA seqDB search
MEENRWFLNIIQDGFMNGKIDFDSTVKLLEKLHMPFNLAHVKHVFKKTVDKRKIHTINIE
DFRAIYRAIVHRNEFHEIFCAYSENRKNLADTELTAFLKKEQFKTEGAETTALEVILKYE
PIDEVRKRRQLSFEGFIRYMSSEDCTIFKKEHRTVYQDMNHPLCDYFISSSHNTYLVSDQ
LIGPSDLNGYISALLKGCRCLEIDCWDGSNNDPVVYHGHTLTSKITFCSVIHVVDKYAFA
ASDYPVVLSLENHCSTKQQERIAQYLLNILGDKLLTSPIGDIEVTQLPSPEALKFKILVK
NKKCGTIEETMLRKGRDSHGETGEVSEEEITSSDEETDEKTPLYPKSGSSKRKSEGRSSP
PPRKKAKVKKMKIAMGLSDLVIYTKSEKFVSFEHSLAHQKCYENNSIGELKAQKFVKHAA
NQFVSHTSRFITRIYPKGTRAGSSNYNPQEFWNVGCQMVALNFQTSGTPMELQNGKFLDN
GGCGYILKPEFLRNRNSTFNPHNVGRYSNPLSLSIRLISGHQLPPSNLSKSNKADPLVQL
EIYGVPEDQAKRKSSVIKSNALSPRWDETFSFTVQVPELALIRFCVQDEISLVANDFLGQ
YTLPLLSLSKGYCTVPLFSKSGGKLEPASLFVYVWYY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaacagatggtttttgaacatcattcaggatggcttcatgaatgggaagatt
gattttgatagcaccgttaaactacttgaaaaactgcatatgccttttaatctcgcccat
gtgaaacatgttttcaagaaaacagttgacaagcggaagatacatactattaacatagaa
gacttcagagcaatttatcgggctattgtacacagaaatgaatttcatgaaattttctgc
gcttactctgaaaaccgcaaaaatcttgctgacactgagctcactgcatttctcaaaaaa
gagcaatttaaaactgaaggtgctgaaacaactgccttagaagttatcttgaagtatgaa
cccattgatgaagttaggaaaagaagacaattgtcatttgaaggatttataaggtacatg
agttcagaagattgtacaatattcaaaaaagagcaccggaccgtctaccaagatatgaac
caccctttatgtgactattttatttcatcttctcacaatacctacttggtatctgaccag
ctaataggacccagcgatttaaatggatatatcagtgctctgttaaaaggatgtcgttgt
ctggaaattgactgctgggatggctcaaacaacgatcctgttgtgtatcatggtcacacc
ttaacaagcaaaattacattttgttctgtaattcacgtagtagacaagtatgcttttgcg
gcatctgattatccagttgtgctgtctttggagaatcactgcagcactaagcaacaagaa
aggatagcacaatatttactgaatattctaggtgacaaacttcttacttcaccaatcggt
gacatagaagtgactcaactaccttctcctgaggcattaaaattcaaaatattggtaaaa
aataagaaatgtggaacaattgaagaaactatgctcaggaaaggtcgggacagtcatggt
gaaacaggggaagtatctgaagaggaaattacatcaagtgatgaggagactgatgaaaaa
acccctctttacccaaagagtggttcctcaaaaagaaaatctgaaggtagatcttcacct
ccacctcgaaaaaaggcaaaggtgaagaagatgaagattgccatggggttgtcggacctt
gtgatttataccaaatctgagaagtttgtaagctttgagcattcattagctcatcagaag
tgttatgaaaacaattcaattggagagcttaaagcacaaaaatttgtaaaacatgcagct
aatcagtttgtttcacatacttcacgtttcattacaagaatctacccaaaaggaacaaga
gcaggttcttcaaattataatcctcaagagttctggaatgtgggttgccaaatggtggcc
ttaaacttccagacatcaggaacaccaatggaactgcaaaatgggaaattcttagacaat
ggtggctgtggatatattctgaaaccagaattccttagaaatcgcaattcaacattcaac
ccacacaacgtgggaagatatagtaacccactatctctatcaataaggctcatcagtggt
catcagttaccacccagtaacctgtcgaagagtaacaaagctgaccctttagtgcagtta
gaaatttacggtgtgccagaagatcaagcaaaaagaaaatctagtgtcataaaaagcaat
gctctgagtccgagatgggatgaaactttctcttttactgtccaagttccagaactagca
ctgatacgcttctgcgtacaagatgagatctctctggttgcaaatgatttcctcggtcaa
tacactttaccactgttgagtttgagtaaaggttactgtactgttccgctgttttccaaa
tctggtggcaaacttgaacctgcatctctgtttgtgtatgtctggtactactaa

DBGET integrated database retrieval system