KEGG   Gallus gallus (chicken): 418182Help
Entry
418182            CDS       T01006                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    418182 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    418182 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    418182 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    418182 (PLCZ1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     418182 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 637 aa AA seqDB search
MEENRWFLNIIQDGFMNGKIDFDSTVKLLEKLHMPFNLAHVKHVFKKTVDKRKIHTINIE
DFRAIYRAIVHRNEFHEIFCAYSENRKNLADTELTAFLKKEQFKTEGAETTALEVILKYE
PIDEVRKRRQLSFEGFIRYMSSEDCTIFKKEHRTVYQDMNHPLCDYFISSSHNTYLVSDQ
LIGPSDLNGYISALLKGCRCLEIDCWDGSNNDPVVYHGHTLTSKITFCSVIHVVDKYAFA
ASDYPVVLSLENHCSTKQQERIAQYLLNILGDKLLTSPIGDIEVTQLPSPEALKFKILVK
NKKCGTIEETMLRKGRDSHGETGEVSEEEITSSDEETDEKTPLYPKSGSSKRKSEGRSSP
PPRKKAKVKKMKIAMGLSDLVIYTKSEKFVSFEHSLAHQKCYENNSIGELKAQKFVKHAA
NQFVSHTSRFITRIYPKGTRAGSSNYNPQEFWNVGCQMVALNFQTSGTPMELQNGKFLDN
GGCGYILKPEFLRNRNSTFNPHNVGRYSNPLSLSIRLISGHQLPPSNLSKSNKADPLVQL
EIYGVPEDQAKRKSSVIKSNALSPRWDETFSFTVQVPELALIRFCVQDEISLVANDFLGQ
YTLPLLSLSKGYCTVPLFSKSGGKLEPASLFVYVWYY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaacagatggtttttgaacatcattcaggatggcttcatgaatgggaagatt
gattttgatagcaccgttaaactacttgaaaaactgcatatgccttttaatctcgcccat
gtgaaacatgttttcaagaaaacagttgacaagcggaagatacatactattaacatagaa
gacttcagagcaatttatcgggctattgtacacagaaatgaatttcatgaaattttctgc
gcttactctgaaaaccgcaaaaatcttgctgacactgagctcactgcatttctcaaaaaa
gagcaatttaaaactgaaggtgctgaaacaactgccttagaagttatcttgaagtatgaa
cccattgatgaagttaggaaaagaagacaattgtcatttgaaggatttataaggtacatg
agttcagaagattgtacaatattcaaaaaagagcaccggaccgtctaccaagatatgaac
caccctttatgtgactattttatttcatcttctcacaatacctacttggtatctgaccag
ctaataggacccagcgatttaaatggatatatcagtgctctgttaaaaggatgtcgttgt
ctggaaattgactgctgggatggctcaaacaacgatcctgttgtgtatcatggtcacacc
ttaacaagcaaaattacattttgttctgtaattcacgtagtagacaagtatgcttttgcg
gcatctgattatccagttgtgctgtctttggagaatcactgcagcactaagcaacaagaa
aggatagcacaatatttactgaatattctaggtgacaaacttcttacttcaccaatcggt
gacatagaagtgactcaactaccttctcctgaggcattaaaattcaaaatattggtaaaa
aataagaaatgtggaacaattgaagaaactatgctcaggaaaggtcgggacagtcatggt
gaaacaggggaagtatctgaagaggaaattacatcaagtgatgaggagactgatgaaaaa
acccctctttacccaaagagtggttcctcaaaaagaaaatctgaaggtagatcttcacct
ccacctcgaaaaaaggcaaaggtgaagaagatgaagattgccatggggttgtcggacctt
gtgatttataccaaatctgagaagtttgtaagctttgagcattcattagctcatcagaag
tgttatgaaaacaattcaattggagagcttaaagcacaaaaatttgtaaaacatgcagct
aatcagtttgtttcacatacttcacgtttcattacaagaatctacccaaaaggaacaaga
gcaggttcttcaaattataatcctcaagagttctggaatgtgggttgccaaatggtggcc
ttaaacttccagacatcaggaacaccaatggaactgcaaaatgggaaattcttagacaat
ggtggctgtggatatattctgaaaccagaattccttagaaatcgcaattcaacattcaac
ccacacaacgtgggaagatatagtaacccactatctctatcaataaggctcatcagtggt
catcagttaccacccagtaacctgtcgaagagtaacaaagctgaccctttagtgcagtta
gaaatttacggtgtgccagaagatcaagcaaaaagaaaatctagtgtcataaaaagcaat
gctctgagtccgagatgggatgaaactttctcttttactgtccaagttccagaactagca
ctgatacgcttctgcgtacaagatgagatctctctggttgcaaatgatttcctcggtcaa
tacactttaccactgttgagtttgagtaaaggttactgtactgttccgctgttttccaaa
tctggtggcaaacttgaacctgcatctctgtttgtgtatgtctggtactactaa

DBGET integrated database retrieval system