KEGG   Gallus gallus (chicken): 418201Help
Entry
418201            CDS       T01006                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    418201 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    418201 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    418201 (GYS2)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     418201 (GYS2)
Glycosyltransferases [BR:gga01003]
 Polysaccharide
  Storage polysaccharide
   418201 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 640 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAMDTMKSQGCQLSCQFDDKPNVVAHFHEWQ
AGVGLILSRSQKLPVATIFTTHATLLGRYLCAANIDFYNNLDQFDIDKEAGERQIYHRYC
MERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSMYKAR
IQEFIRGHFYGHLDFSLENTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSDVTVV
VFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLSKILDRD
DITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVIVHPEFLS
STSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVA
DPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWRYLGR
YYMHARHLALSRTFPDKFEMEPCAPPKTEGFRFPRPSSVPPSPSVSQHSSPHQSEGEDED
EDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEFRN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgacctctcttaatgggcttcctcagtgggaagat
gaagacctaccagtggaggacttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggaatttataccgtgatccagacaaaagccaaaattacggcagatgaatggggt
gaaaactattttctgattggtccttattttgagcacaatgtgaagactcaggtggaagta
tgtgagcctccaaaccccgcaattaagaaggcaatggataccatgaaaagccaagggtgt
cagctttcctgccagtttgatgacaagcccaacgtagttgctcatttccatgaatggcag
gcaggagtgggtttaatactgtcgcgatctcagaaacttccagttgccactatttttact
acccatgccactctgcttgggagatacctgtgtgcagccaatatagacttttacaacaat
cttgaccagtttgacattgacaaggaagcaggagagagacagatttaccatcgatattgt
atggaacgggcatctgtacactgtgcccatgtgttcaccacagtctcacagataacagca
attgaagcagaacacatgcttaaaagaaatcctgatgttgtcactccaaatggcttgaac
attaagaagttttcagcaatgcatgaatttcagaatttgcattccatgtacaaggctagg
atccaagagttcattcgaggtcatttctatggccaccttgacttcagtcttgaaaatacc
ttatttttcttcattgctgggagatatgagttttccaacaaaggagctgatatgtttcta
gaagccttatcaagactaaactttttgctgagggtacataagagtgatgttacagtcgtt
gtgtttttcattatgccagcaaagacaaacaatttcaatgtggaaaccttgaaaggacaa
gcggtccggaagcagctctgggacactgcgcaatctgtgaaagaaaagtttggaaagaaa
ctctacaatgccttactaaaaggagaaattccagacttgagcaagatccttgaccgggat
gatataaccattatgaaaagagccatcttttcaactcagcgacactgtctgcctccggtg
actacccacaacatgattgatgatggcaacgatccaatactcaacaccatccgacgtatt
ggccttttcaacaaccgaacagacagagtaaaggtgatcgtacatccagagtttctttct
tcgacaagcccattgctgcccttggactatgaagaatttgttagaggttgtcacttgggt
gtatttccatcatactatgaaccctggggttacactccagctgaatgtactgtgatgggt
attcccagtgtgaccacaaacctttctggattcggctgtttcatgcaggaacatgttgct
gacccagctgcttatggcatctacatagttgacaggaggttccgttcacctgatgaatca
tgcaaccagctgactcagttcctgtatggattttgtcagcagtcccgtcgccagaggatc
atccaaagaaaccgaactgagaggctctcagatctgttggactggagatacctaggcagg
tattatatgcatgccagacacttggccctcagcagaacgttccctgataaatttgagatg
gaaccatgtgctccaccaaagacggaaggtttcagattcccaagaccttcatcagtgcca
ccatcgccttctgtctctcagcattccagccctcaccaaagcgaaggtgaagatgaagat
gaggatgaaagatatgatgaggatgaggaagctgaaagggataggcaaaatatcaagtct
ccattttcacttggagtattgccacaaggaaagaagaagcagcatggagagttcaggaac
tga

DBGET integrated database retrieval system