KEGG   Gallus gallus (chicken): 418201Help
Entry
418201            CDS       T01006                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    418201 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    418201 (GYS2)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     418201 (GYS2)
Glycosyltransferases [BR:gga01003]
 Polysaccharide
  Storage polysaccharide
   418201 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKITADEWG
ENYFLIGPYFEHNVKTQVEVCEPPNPAIKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDRWKGEFWDATNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNVVAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAANIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLENTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKSD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLSKI
LDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVIVHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPCAPPKTEGFRFPRPSSVPPSPSVSQHSSPHQSEG
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEFRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgacctctcttaatgggcttcctcagtgggaagat
gaagacctaccagtggaggacttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggaatttataccgtgatccagacaaaagccaaaattacggcagatgaatggggt
gaaaactattttctgattggtccttattttgagcacaatgtgaagactcaggtggaagta
tgtgagcctccaaaccccgcaattaagaaggcaatggataccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgacata
ggatcagcagcctggaatctggacagatggaaaggcgaattttgggatgctaccaacata
gggatcccttttcatgaccgagaagccaatgatgctgtaatttttggatcattaacagcc
tggtttttaaaagagctttcctgccagtttgatgacaagcccaacgtagttgctcatttc
catgaatggcaggcaggagtgggtttaatactgtcgcgatctcagaaacttccagttgcc
actatttttactacccatgccactctgcttgggagatacctgtgtgcagccaatatagac
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcgatattgtatggaacgggcatctgtacactgtgcccatgtgttcaccacagtctca
cagataacagcaattgaagcagaacacatgcttaaaagaaatcctgatgttgtcactcca
aatggcttgaacattaagaagttttcagcaatgcatgaatttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgaaaataccttatttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagactaaactttttgctgagggtacataagagtgat
gttacagtcgttgtgtttttcattatgccagcaaagacaaacaatttcaatgtggaaacc
ttgaaaggacaagcggtccggaagcagctctgggacactgcgcaatctgtgaaagaaaag
tttggaaagaaactctacaatgccttactaaaaggagaaattccagacttgagcaagatc
cttgaccgggatgatataaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgcctccggtgactacccacaacatgattgatgatggcaacgatccaatactcaacacc
atccgacgtattggccttttcaacaaccgaacagacagagtaaaggtgatcgtacatcca
gagtttctttcttcgacaagcccattgctgcccttggactatgaagaatttgttagaggt
tgtcacttgggtgtatttccatcatactatgaaccctggggttacactccagctgaatgt
actgtgatgggtattcccagtgtgaccacaaacctttctggattcggctgtttcatgcag
gaacatgttgctgacccagctgcttatggcatctacatagttgacaggaggttccgttca
cctgatgaatcatgcaaccagctgactcagttcctgtatggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagaggctctcagatctgttggactggaga
tacctaggcaggtattatatgcatgccagacacttggccctcagcagaacgttccctgat
aaatttgagatggaaccatgtgctccaccaaagacggaaggtttcagattcccaagacct
tcatcagtgccaccatcgccttctgtctctcagcattccagccctcaccaaagcgaaggt
gaagatgaagatgaggatgaaagatatgatgaggatgaggaagctgaaagggataggcaa
aatatcaagtctccattttcacttggagtattgccacaaggaaagaagaagcagcatgga
gagttcaggaactga

DBGET integrated database retrieval system