KEGG   Gallus gallus (chicken): 418220Help
Entry
418220            CDS       T01006                                 

Gene name
CYB5R3
Definition
cytochrome b5 reductase 3
Orthology
K01988  
lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    418220 (CYB5R3)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     418220 (CYB5R3)
Glycosyltransferases [BR:gga01003]
 Glycan extension
  P blood group
   418220 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 515 aa AA seqDB search
MSRAELPPTSGQVKSSPVLQYAKHSWDCSDGRRLRGDLIAPSNSPQGGSGDVAVGFFSWR
GSASRPLSAQPQRPPGPAGRHPNTELTVILPRWGGSAPPRGGCGRAGRGRRCPGRRLGDP
ARVRLRSRTRPGPEAPPEGAEITAFLLGEQALMGTRMLRMPNCLLKLTRVVLGHKLRALF
ILAFKFMSFVSIVLYWRITQDSKGRDQTYLPVQIHCAHSVPSPPCAVADGPSPPPGDVFF
VETSERTNPNYLFMCSVESAARTHPGTRVVVLMKGLANRNASLPNHWGFSLLSCFPNVEI
RPLDLPELFSGTPLAQWYLQAQQRWEPYFLPILSDACRIAIMWKFGGIYLDTDFIVLKNL
KNLTNVLGTQSKYVLNGAFLSFTPKHKFIELCMQDFVENYNSWIWGHQGPQLLTRVFKKW
CSIRSLRSSKSCKGVSALPREAFYPIRWQDWKKYFEVVSSTELNELLKNTYAVHVWNKKS
QGTRLEITSQALLAQLHSLFCPATYDVLKMDFKWH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagcagaattgcctcccacctcagggcaggtaaaaagctctcccgttttgcaa
tatgcaaaacacagctgggattgttcagacgggaggagactgaggggagaccttattgct
ccctccaactccccgcaaggaggtagtggcgatgtggccgtcggcttcttctcctggcgt
ggctctgcatcccgacccctttcagcgcagccccaacgcccgcccggccccgcaggccga
catcccaacacggagctcaccgtgattcttccaagatggggcggctccgctccgcctaga
ggaggctgcgggcgggcggggcgggggcggcgctgcccgggccggcggctgggggacccg
gcccgggttcgactgcggtcccggacccgacccggccccgaggcgccgccggagggcgcg
gagatcacagcatttcttctgggagagcaagctctgatgggaacaagaatgctcagaatg
ccaaactgcctgctaaagctgacccgggtggtgctgggccacaagctcagggctctcttc
atccttgcctttaagttcatgtcctttgtctccattgtgctgtactggaggatcacacag
gactctaagggcagggaccaaacctacttgcctgttcagatccactgtgctcactctgtt
ccgtctcctccctgtgccgttgctgatggaccttctcctcccccaggagatgtgtttttt
gtggaaacctccgaacgaaccaacccaaattacctgttcatgtgctctgtggagtcagct
gcccggacgcacccggggacaagggttgtggtgctcatgaaaggcctggcaaacagaaat
gcctcattacccaaccactggggcttctcattgctgagctgcttccccaacgtggaaatt
cgtcccttggatttgccagagctattctctgggacacctctagcacaatggtatttgcag
gctcagcagcgctgggaaccttatttcctacccatcctgtctgatgcctgcagaattgcc
atcatgtggaaatttggtggcatctacctggacacagacttcattgtgcttaagaactta
aagaacctcaccaatgtgcttggcacccagtccaagtatgtactgaatggagcctttctg
tcctttacacccaaacacaagttcatagagctttgtatgcaggactttgtggagaactac
aacagctggatctgggggcatcaaggcccacagctcctaacgcgtgtctttaagaaatgg
tgttccatcaggagtcttcggagcagtaagagctgcaaaggggtgagtgctctgccccga
gaggctttttatcccattcgatggcaggactggaagaaatacttcgaagtggtcagctcc
actgagctgaatgaactcctgaagaacacctatgctgtgcatgtatggaacaagaagagc
caagggacaaggctagagatcacatcgcaggctttgctggctcagctgcattctcttttc
tgccctgccacatatgatgtcttgaagatggactttaaatggcactga

DBGET integrated database retrieval system