KEGG   Gallus gallus (chicken): 418290Help
Entry
418290            CDS       T01006                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     418290 (USP5)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   418290 (USP5)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   418290 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 855 aa AA seqDB search
MAELSEALLSVLPSIRVPKAGDRVHKDECAFSFDTPESDGGLYICMNTFLGFGKQYVEKH
YQKTGQRVYLHLKRTRKPKEEDANSSAGDPPRKKPTRLAIGVEGGFDITEEKFEYDEDVK
IVIFPEHLDIPRDGLEGLPDMVRDRIASAVEAILTADSASRKQEVQAWDGEVRRVSKHAF
SLHQLQNDVRIPPCGWKCSKCDMRENLWLNMTDGAILCGRRYFDGSGGNNHAVEHYRETG
YPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFGIDMLKMQKTDKTMTELEIDMN
QRIGEWELIQESGVQLKPLYGPGYTGIRNLGNSCYLNSVMQVLFSIPDFQRKYVDKLEKI
FQSAPSDPTQDFSTQVAKLGHGLLSGEYSKPASAEGEQQPDQKGVQNGIAPRMFKALIGK
GHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKLKCLATEKVKYTQRV
DYIMQLPVPMDAALNKDELLEYEEKKRQAEEEKQPLPELVRAKVPFSSCLEAYGAPEQVD
DFWSTALQAKSVALKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISALQ
GTGLQDGEEEMPDIAPPLVTPDEPKGSLGFYGNEDDDSFCSPHFSSPTSPMLDESVIIQL
VEMGFPMDACRKAVYYTGNSGVEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTIACPDPP
SEDSVATIVSMGFSRDQAMKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAAES
ISESVPVGPKVRNGPGKYQLFAFISHMGTSTMCGHYVCHIKKDGRWVIYNDQKVCASEKP
PKDLGYIYFYQRIPS
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagcgaagcgctgctctcggtgttgccgtccatccgggtgcctaaggcc
ggcgaccgggtccataaggacgagtgcgccttctccttcgacacgccggaatccgatggc
ggcttatatatctgcatgaacacgttcctgggctttgggaaacagtatgtggaaaagcac
taccagaaaacaggccagcgggtctatctgcacctcaaaagaacacgtaaaccgaaggaa
gaagatgctaattccagtgccggggaccccccaaggaagaaaccaactcgcttggctatt
ggtgtagaaggtggatttgacatcacagaggaaaagtttgaatatgatgaagatgtaaaa
atagtaattttcccggaacatttggatattccccgtgatgggctggagggactacctgac
atggtcagagacaggattgccagtgcggttgaagccatccttacagcagactcagcttcc
cggaagcaggaggtgcaggcttgggatggggaggttcgacgtgtttctaaacacgctttt
tccctgcaccaacttcagaatgatgtccgcatcccaccatgtggctggaagtgcagcaag
tgtgacatgagggagaacctgtggctgaacatgactgatggagccatcctctgtggtcgg
cgctattttgatggcagtggtggcaacaatcatgcagtcgagcactaccgggaaactggc
tacccactggctgtgaaactgggaacaattactcctgatggggccgatgtctactcctac
gatgaggatgacatggtgttggatcccaacctggcagaacacctcgctcactttgggatt
gacatgcttaagatgcagaagacagacaagacaatgacagaactggaaatagacatgaat
caacgtattggggagtgggagctcatccaggagtctggtgtgcagctcaagcccctctat
gggcctgggtacactggtatccgtaacctgggcaacagttgctacctcaattctgtgatg
caggtgctgttcagtatcccggacttccagagaaagtatgtggacaagctggagaagata
ttccaaagcgcaccttcggatcccacacaggacttcagcacacaagtagccaaactgggt
catggtctgctatctggggagtattcaaagccagcttctgcagaaggggaacagcagcct
gatcagaagggtgtacaaaatggcattgctccacgcatgtttaaggccctcattggaaag
ggacacccggaattttccactaaccggcagcaggatgcccaggaattctttctgcacttc
atcaacatggtggagaggaactgccgcagctcggagaaccctaatgaggtcttccgtttt
ctggtggaggagaaactgaagtgtctggccacagaaaaggtgaaatacacccagcgtgtg
gactatatcatgcagctgccagtacccatggatgctgcactcaacaaagatgaactactg
gaatatgaggagaagaagcggcaggcagaggaagagaagcagccactgcctgagctggtg
cgagccaaggtgcctttcagctcctgcctagaggcctatggagctccagagcaggtggat
gatttctggagcacagccttgcaggccaagtctgtggctctcaaaacaacgcggtttgcc
tctttcccagattatctggtgattcagatcaagaagttcacttttggtctggactgggtg
cccaaaaagcttgatgtctccattgaaatgccagaggagctggatatctctgcactgcag
ggaacagggctgcaggatggagaagaagaaatgccagacattgcacccccactggtgaca
ccagatgagcccaaaggtagcctggggttctatggcaacgaggacgacgactccttctgc
tcccctcacttctcctctccgacatcccccatgttggatgagtcagtgattatccagcta
gtggagatgggctttcccatggatgcttgccgcaaagctgtgtattacacagggaacagt
ggggttgaagctgccatgaactgggtcatgtcacacatggatgatccagattttgctaac
ccgctagttctccctggatccagtggaccagggtcaactattgcctgtccagaccctcca
tcagaagacagcgtggccaccattgtctccatgggcttctcccgggaccaggctatgaaa
gcactaagagcaacgaacaacagcctggagcgtgcagtggattggatctttagtcacatt
gatgaccttgatgcagaagctgctatggatatctcagaggggcgttcggcagcagagtcc
atctctgaatctgttcctgttggtcctaaagtgcgcaatgggcctggaaaatatcagctg
tttgccttcatcagccacatgggcacttcgactatgtgtggtcactatgtttgtcacatc
aagaaagatggcaggtgggtgatctacaatgaccagaaggtctgtgcttctgagaagccc
cccaaggacctgggctacatctacttctatcagcggattcccagctag

DBGET integrated database retrieval system