KEGG   Gallus gallus (chicken): 418485Help
Entry
418485            CDS       T01006                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 818 aa AA seqDB search
MGKKRTKGKTAQADESMDIVEPVCKHIRKGLEQSHLKKALLNVEWHVCQDCKADNKTQEK
SEEETDESPSIWLCLKCGHRGCGRNSQEQHALKHYTTPRSDPHCLVLSLDNWSVWCYICD
NEVPYSTSTRLGQTVDYIKKQVCVNSSHLEKQQENKDVGNKKVEKDSRNEQQKEVLLKES
SHSSTSSEVTVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEAKMPDTTVKIDSPELSME
PQLVKLDQPGPLTLAMHQFLTEMQETKRGVVTPKELFAQVCKKAIRFKGYQQQDSQELLR
YLLDGMRAEEIQRISVGILKALTDSDKQNEEELRKKIKEYEKKKGIKSFVDRIFGGELTS
TIMCEECRTVSLVHESFLDLSLPVLDDQKIKNTNERNVKKIKGRESEEEEEDKNNDYYIK
QRDEPPGTSKHLQKKAKKQAKKQAKSQRRQQKLQGKVLQLTDICATEESEKDVVCDQEGE
AEINSEISDVKQEEESSNDCKDDYLTQNDLNIQGSSTDVQSMHESTGKPEQEKESTANLP
TEDLDSPVEFVNGLDDLSLKDEDEENEDEEGLATDFSKLHLSANAESDINVLDDLQTAPA
KTCEILTEDAEMAFCTLANREDLNPEEGSIHQCLYQFTRNEKLSENNKLLCDICTQRRYG
PKNTKNEKHVYTNAKKQMLISLAPPILTLHLKRFQQAGFNLRKVNRHIKFPEVIDLAPFC
TVKCKNVAEGNTKVLYSLYGVVEHSGTMRSGHYTAYAKMRNMNNHLSDLILQGQPPQALE
TEPIKGQWFHISDTHVQAVSTSKVLSSQAYLLFYERLL
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggaccaaaggcaaaactgcacaggctgatgagtctatggatatagtg
gagcctgtgtgcaagcatattcgtaaaggactggaacaaagccatctgaaaaaggcactg
ctgaacgtggaatggcatgtttgtcaggactgcaaggcggacaacaagacacaagagaaa
tctgaggaagagactgatgaaagcccctcgatatggttatgtctaaaatgtggccatagg
ggctgtggcagaaattctcaagagcagcatgctttaaagcattacacaacgccaagatca
gatccccattgtttggttctcagtttggacaactggagtgtgtggtgctacatatgtgat
aatgaagttccatacagtacttcaacacgtttgggccagactgtggattatattaaaaaa
caagtttgtgtcaactcatcacatttagaaaagcaacaagagaacaaagacgttggaaat
aaaaaggtagaaaaagacagcagaaatgagcaacaaaaagaagttttgctgaaagagagt
tctcattccagtaccagctctgaagtgactgtgaaaggacttagtaacctggggaataca
tgtttcttcaacgcagtgatgcagaatttatcacagactccagtcctcagggagctgctt
aaagaagctaaaatgcctgacacaacagttaagattgattcacccgagttatccatggaa
cctcagctggtaaaactagatcagccaggtcctttgactttagccatgcatcaattcctg
acagaaatgcaagagacaaagagaggggttgtcactcctaaggaactttttgctcaggtt
tgtaaaaaggcaatacgatttaaaggttatcagcagcaggacagtcaagagttgcttcga
tacttacttgatggaatgagagcagaagaaatccaacgaataagtgttggaatactgaag
gctctgactgattcagacaaacaaaatgaagaagaactgagaaagaaaattaaagaatat
gaaaagaagaagggaataaagagttttgtagatcggatctttggtggagaattaaccagt
acaattatgtgtgaggaatgcagaacagtatccttggtccatgaatccttccttgatttg
tcgcttcctgtactagatgatcagaaaataaaaaatacaaatgagaggaatgtaaaaaaa
atcaaaggaagggaatctgaagaggaagaagaggataaaaacaatgattattatattaaa
cagagagatgagcccccaggtacaagtaagcaccttcagaaaaaagcaaagaaacaggcc
aaaaaacaagccaagagccagcgccgccagcaaaaactccagggaaaggtacttcaattg
acagatatctgtgctactgaagagtcagaaaaagatgtagtatgtgaccaggaaggagag
gcagaaattaactctgaaatttctgatgtgaagcaggaagaggaatcatcaaatgattgc
aaagatgactacttaactcaaaatgacttaaatatacagggaagtagtacagatgttcag
agcatgcatgaaagcacaggaaagccagaacaagaaaaggagtctacagcaaatctcccc
acagaagacttagattctcctgtagagtttgtcaatggccttgatgacctatctttgaaa
gatgaggatgaagaaaatgaagatgaggaagggcttgctactgacttctcaaaactacac
ttgagtgccaatgctgaatctgatataaacgtcttagatgatcttcaaactgctccagcc
aagacgtgtgaaatattgaccgaagatgcagaaatggcattttgtactcttgctaacagg
gaagacctgaacccagaagaaggctcaatccatcagtgtttgtatcaatttacccgtaat
gagaaacttagtgagaacaataaactgctgtgtgatatatgtacacaaagacgttatgga
ccaaagaacacaaaaaatgaaaagcatgtttatactaatgccaaaaagcaaatgctgatt
tctcttgctcctccaattttaactcttcacttaaagagatttcaacaggctggatttaac
ctacggaaggttaacaggcacatcaagtttccagaagtgatagacttggctcctttctgt
acagttaaatgtaaaaacgtggctgaagggaatacaaaagtattatactctctctatgga
gttgttgaacacagtggaacaatgaggtctgggcactacactgcttacgctaaaatgaga
aatatgaacaaccatctttcagatcttatccttcaaggacaacctcctcaagctttagaa
actgaaccgataaaaggacagtggttccacatcagtgatacccatgtacaagctgtgtct
acatctaaagtgctgagctcacaagcctatcttctgttctatgagcgactgctgtaa

DBGET integrated database retrieval system