KEGG   Gallus gallus (chicken): 418569Help
Entry
418569            CDS       T01006                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 2555 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHLYNGTRPSETVPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FMSGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMESMRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GNDDIANRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVE
DLDIWSHTNDTIGQVRRCILNRIKANSAHTKVELFIGGELVDPADDRKLIGQLNLKDKTL
ITAKLTQINSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDNTTVEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPASAPLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVEGTSTVNPFLQINQATHDQAVV
LQNALQNIPNPTSECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGCGSVQLV
FSSNEEISKIYEKTNAGNEPDMEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFII
DLLLHCHSKIVRQMAQEQFFLMATRCCMGQRPLLFFITLLFTVLGSTARERAKHSGDYFT
LLRHLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLGVTKEL
LAFQTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPAT
INAGFELLVALAVGCVRNLKQIVDTLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFV
GLKNAGATCYMNSVIQQLYMIPAIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDV
FGYPHQYEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEP
VNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESF
TTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQL
KRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQIIQNEQSENEHS
GSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKN
QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDKDSELTKYISELAITTKP
HQIKMPSAIERSVRKQNVQFMHNRMQYSLEYFQFIKKLLTCNSVYLNPPPGQDHLLPEAE
EITMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSN
RFSEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLR
AVLNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVALDEGPGPPI
KYQYAELGKLYTVVSQLIRCCNVSSRMQSSINGNPPLANPYGDPNLSQPIMALQQNVADI
LFVRTSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLD
LLLQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNC
PVAYQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPIQSNETSNGYFLE
RSHSARMTLAKACELCPEEEPDDPDAPDEHESSPPEDAPLYPHSPGSQYQQNNHVHGQPY
TGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKD
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccggtaggaggcaatgatagccagggccaggctcct
gatggacagtcccagcctcccctccagcagaatcagacatcttcacctgattcttcaaat
gagaactctccagctaccccgcctgatgagcagggccaaggagatgctccacctcagctt
gaagatgaggagcctgcatttccacacacagacctggcaaagttggatgacatgatcaac
aggcctcgatgggttgttcctgtgttgccgaagggggaattagaagttcttctagaagct
gctattgatctgagtaaaaaaggccttgatgtcaaaagcgaagcatgccagcgatttttt
cgagatgggttgacaatatctttcacaaaaatccttactgatgaggcagtgagcggctgg
aagtttgaaatccatagatgtattattaacaacactcatcgactagtagaactctgtgtg
gccaagctgtcccaggattggtttccccttcttgaacttcttgccatggccttaaatcct
cactgcaaattccatctatacaatggtacacgtccctctgaaacagttcctgcaggagtc
cagctcgctgaagatgaactttatgcacgtcctcctgacccacgctcaccaaaaggttgg
ctagtagatctcatcaacaagtttggcacattaaatggattccagatcttgcatgatcgc
ttcatgagtggatcagcattgaatgttcagataattgcagctctcatcaagccatttgga
caatgttacgaatttctaacattgcatacagtgaagaaatatttccttccaattatagaa
atggttccacaatttttagaaaatctaacagatgatgaactgaaaaaagaggcaaagaat
gaagccaaaaatgatgctctatcaatgataatcaaatctctaaagaacttagcttcaaga
gttccaggacaagaagaaactgtaaaaaacttagaaatatttaggttaaaaatgattctt
aggttgttacaaatttcttctttcaatggtaaaatgaatgcactaaatgaagttaacaaa
gtaatatccagtgtatcatattatacccaccggcatggtaatcctgaagaggaagaatgg
cttacagctgaaagaatggcagaatggatccagcagaataatattttatcaattgtgttg
agagatagtcttcatcaacctcaatatgtagagaagttagagaagattcttcgttttgtc
atcaaagaaaaagccctcaccttgcaggatcttgacaacatttgggctgcacaggcagga
aaacatgaagccattgtaaagaatgtacacgacctccttgcaaaattagcttgggatttc
tctcctgaacagcttgatcacttgttcgattgttttaaggcaagttggacaaatgcaagc
aaaaaacagcgtgagaagctacttgagctaatccgtcgtcttgcagaagatgacaaggat
ggtgtgatggcacacaaagtgctgaaccttttgtggaatctggctcacagtgatgatgta
ccagttgatatcatggaccaggctcttagtgcccatattaaaatcttagattacagctgt
tcacaggatcgagatacacaaaagatccagtggatagatcgttttatagaagagcttcgc
acaaatgacaaatgggtcattcctgcactgaaacaaattagagaaatttgcagtttgttt
ggtgaagcaccacaaaacttgagtcaaacacagcgaagtccccatgtgttttaccgacat
gacttaatcaatcaacttcagcacaatcatgccctagtgacattggttgcagaaaatctg
tctgcctatatggaaagcatgaggcagtatgctaaagagcatggtgaatatgatccacaa
accgtaagaccaggaagcagatacagtcatgtacaagaagtacaggagcgacttaatttc
ttaagatttttattgaaggatggtcagctgtggctctgtgcccctcaggcgaagcaaata
tggaagtgtttagctgaaaatgctgtttatctttgtgatcgcgaagcctgttttaaatgg
tattccaaactaatgggggatgaaccagacttagaccctgacattaataaggacttcttt
gaaaataatgtgcttcagctggatccttccctattaacagaaaatggaatgaaatgtttt
gaacgtttcttcaaagctgtgaactgtcgagaaggaaagctagtagcaaagagacgagcc
tatatgatggatgatctggaattaataggattagactacctttggagggttgtgattcag
ggaaacgatgacatcgcaaatagagcaattgatcttctcaaagagatctatactaacctt
ggtccaaggttacaagttaatcaggtagtgattcatgaagacttcattcagtcctgtttt
gatcgtctcaaagcctcctatgatacattatgtgtgttggacggagataaagatagtatt
aattgtgcaagacaagaagcaatacgaatggtgagagtgttgactgttttaagagaatat
ataaatgaatgtgacagtgactaccatgaagaaagaactattctacctatgtcaagagct
ttccgtggaaaacatatcacactggtagttcgttttccaaaccaaggccgacaggtggaa
gatttggatatttggtctcacaccaatgacacgattggccaagtgcggcgttgtattctc
aatcgtattaaagccaacagtgcgcacacaaaagtagaactgttcattggtggtgagctg
gtggatcctgcagatgatagaaaattaattggacaattgaatctcaaagataaaacgcta
ataacagctaaacttacacagataaattctaatatgccctcaagtcctgatagttcttct
gactcttcaaccggctctcccggcaaccatggcaatcactacagcgatggtccaaaccca
gaagttgaaagctgtttgcctggagtgatcatgtcactgcatcctcgatacatttctttt
ctttggcaagttgcagacttgggcagtagcctaaatatgccacctctaagagatggagca
cgtgttcttatgaagctcatgccaccagataacactacggttgagaaactaagagctatt
tgtttagatcacgcaaaacttggggaaagcagccttagtccatcccttgactctctattt
tttggtccctctgcctcacaagtgctatatctaacagaggtagtttatgccttgttaatg
cctgccagtgcacctctgggagaagatgccagtgacttccagtacaacttcctaaaaagt
ggtggtttgcctcttgtattgagcatgctgactcgaaataactttctgccaaatgcagat
atggaaactcgaaggggtgcctaccttaatgctctaaaaatagccaagttattgctaaca
gcaattggatatggccacgttcgagctgtggcagaagcttgtcaaccagttgtggaaggc
acaagtacagtaaatcctttcttacagataaatcaggctacacatgaccaggcagtggtg
ctacaaaatgccctacaaaacattcctaatccaacttcagaatgcatgctaagaaatgta
gcaatacgtcttgcacagcaaatatctgatgaggcttcaaaatatatacctgatatctgt
gttattagggcagtgcaaaaaattgtctgggcgtctggttgtgggtcagttcaacttgtg
ttcagctctaatgaggaaatcagtaaaatctatgaaaagacaaacgcaggaaatgaacca
gacatggaagatgaacaagtttgctgtgaagcactggaggtgatgaccctatgttttgct
ttgattccaacagcactggatgctctaagtaaagaaaaagcatggcagacgtttatcatt
gatttgctattgcactgtcacagcaaaattgttcgtcagatggcacaggagcagttcttt
ttaatggctaccaggtgttgcatgggacagagacctctccttttcttcattactctgctg
tttacagttctggggagtactgccagagagagagctaagcattcgggagactacttcact
ctcttaagacatcttcttaactatgcttacaacagtaatattaatgtgcccaatgctgaa
gttcttctcaataatgaaattgactggctgaaaaggatcagggatgaagtaaaaaggaca
ggggaaacaggtgttgaagaaaccatcttagagggtcaccttggagtaacgaaagagttg
ttagcattccagacacctgagaagaaataccatattggttgtgaaaaaggaggtgctaat
ctcattaaagaattgatagatgatttcatctttccagcatccaatgtttatttacaatac
atgagaaatggagaattgcctgctgagcaggccataccagtctgtagttcaccagcaact
attaatgctggctttgagctactagttgcactagcagttggatgtgtccgaaatctcaaa
cagatagtagacaccttgactgagatgtattacataggtacagcaatcactacttgtgaa
gcgcttacagaatgggaatatctaccacctgttgggcctcgaccaccaaagggattcgta
ggattaaaaaatgctggtgccacttgttacatgaattctgttattcagcagctttacatg
attccagccatcaggaatgggattcttgcaattgaaggcacaggcagtgatgtagatgat
gatatgtctggggatgaaaagcaggacaatgagagcaatgttgacccacgagatgatgtg
tttggctacccacatcagtatgaagacaaaccagcgctgagtaaaacagaagacagaaaa
gagtacaatattggagtcctgaggcatctccaagtaatttttggtcatttagcggcttcc
aggctacaatactatgtaccaagagggttttggaaacaattcaggctttggggtgaacct
gtaaatctgcgtgaacaacatgatgctttagaattctttaactccttggtggatagttta
gatgaagctttgaaagctttgggccacccagcaatgttaagtaaagttttaggaggatcc
tttgctgatcagaagatttgtcaaggatgccctcataggtacgaatgtgaggaatccttc
acaactctgaatgtagatataagaaatcaccaaaaccttcttgattcgctggaacagtat
gtcaagggagatttattggaaggtgcaaatgcatatcattgtgaaaaatgcaacaaaaag
gttgatacagtgaaacgtttgttgattaagaagttgcctccagttcttgccatccagttg
aagcgatttgattatgactgggaacgggaatgtgcaatcaagttcaacgactattttgaa
tttccaagagagctggacatggagccttacacagtagcaggtgtagctaaattggaagga
gatgatgtaaatcctgaaaatcaaataatacaaaatgaacagtcagaaaatgaacattct
gggagcacaaaatacaggctcgttggtgtgcttgtacatagtggccaggccagtggcgga
cattattactcttatattatccagaggaatggtggagatggtgagaaaaatcgatggtat
aaatttgatgacggagatgtgacagagtgtaaaatggatgatgatgaagaaatgaaaaat
cagtgttttggtggagagtacatgggagaagtatttgatcatatgatgaaacgtatgtcc
tacagacgccagaagaggtggtggaacgcttatattcttttttatgaacgtatggacaca
atagacaaagacagtgaactaacaaaatacatttcggaacttgctatcaccactaaacca
catcaaattaaaatgccgtcagccatcgaacgaagtgtacggaaacagaacgtgcagttc
atgcataatcgtatgcagtacagcctggaatatttccagtttataaagaagttgcttact
tgtaatagtgtctacttaaatcctcctccaggacaagatcatctgttgccggaagcagaa
gaaataactatgattagcattcagcttgctgctagatttctcttcaccacaggatttcat
acaaagaaaatagtccgtggcccagctagtgattggtatgatgcgttatgcattcttctc
cgtcacagcaagaatgtacgcttttggtttgcacacaatgtcctttttaatgtttcaaac
cgcttctctgagtaccttttggaatgccccagtgctgaagtgaggggtgcatttgcaaaa
cttatcgtatttattgcacatttttcgttgcaagatggaccatgtccttcaccttttgcc
tctcctggaccttccagtcaggcttatgataacttaagtttaagcgatcacttactgaga
gcggtactaaatcttcttcgaagggaagtatctgaacatgggcgtcatttgcagcagtat
ttcaatctgtttgtgatgtatgccaatctaggtgtagcagagaagacacaactgctgaaa
ctaaatgttcctgcaaccttcatgcttgtggctctggatgagggtccaggccctcccatt
aagtaccagtatgctgaactggggaagctgtacactgttgtgtcacaactgatccgttgt
tgcaatgtgtcatcgcggatgcagtcttctatcaatggtaatcctccacttgccaacccc
tatggtgatcctaatttatctcaacctataatggcacttcagcagaacgtagcagacatt
ctgtttgtgagaaccagttatgtgaagaaaattattgaagattgcagcaattctgaagag
accatcaaattgcttcgtttctgctgttgggagaatcctcagttctcttccactgtccta
agtgaacttctctggcaggttgcgtattcatacacatacgagcttcgaccttacttggat
ctgcttctgcaaatcctattaattgaggattcttggcaaactcacaggattcacaatgca
cttaagggaatcccagatgacagggatggactatttgacaccattcaacgctccaagaac
cattatcagaaaagagcttaccagtgtataaaatgcatggtagccctcttcagcaactgc
cctgtagcctaccagatccttcagagtaatggagatttgaagagaaaatggacctgggca
gtagaatggcttggagatgagcttgagcgtagaccgtacactggcaatccccaatacacc
tataataattggtctccaccgatacaaagcaatgaaacatcaaatggctacttcctagag
agatcacacagtgctagaatgactcttgcaaaagcttgtgaactctgcccagaggaggaa
ccggatgatcctgatgctccagatgaacatgagtcttctccacctgaagatgcaccactg
tatccccattcacctggttcccagtatcaacagaataaccatgtgcatggacagccatat
acaggcccggcagcacatcatatgaacaaccctcagcgaactggccaacgagcacaagaa
aattatgaaggcagtgaagaagtttccccgcctcagacaaaagattag

DBGET integrated database retrieval system