KEGG   Gallus gallus (chicken): 418589Help
Entry
418589            CDS       T01006                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    418589 (GK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    418589 (GK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     418589 (GK)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   418589 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
1
AA seq 555 aa AA seqDB search
MAASDRMVLGPLVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEI
LRSVHECVERTCEKLQQLNIDITNIKAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQ
STVERLLKRIPGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTID
SWLIWCLTGGKNGGVHCTDVTNASRTMLFNIHSLDWDPELCQFFDIPMEILPKVRSSSEI
YGLMKSGALTGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGQKSVFSDHG
LLTTIAYKLGRDKPVCYALEGSVAIAGAVVRWLRDNLGIVKTSQEVEKLAAEAGTSYGCY
FVPAFSGLYAPYWEPSARGIICGLTQFTNKNHIAFAALEAVCFQTREILDAMNKDCGIPL
SQLQVDGGMTNNKVLMQLQSDILCIPVVKPSMPETTALGAAMAAGAAEGVGIWSLNPGDL
TAVTCERFEPQINPEESEYRYARWKKAVMKSMGWETSEAPSNGDTSIFCSLPLGFFIMSS
MIMLIGAKYVSGTDK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtcggaccgcatggtgctggggccgctggtgggctccatcgatcagggtacc
agttccagccgcttcctggtatttaatgcaaaaacagcagagctcctgagtcaccatcaa
gttgagatacagcagaaattccctaaggaaggatgggtggaacaagatccaaaggaaatc
ttaaggtcagtccatgaatgtgtggaaagaacctgtgagaaactgcagcaactgaacata
gacatcactaacataaaagccattggagttagcaaccagagggaaacaacagtggtttgg
gacaagacgaccggagaacctctttataatgctattgtgtggcttgacctaagaactcag
tcaacagttgaaaggcttcttaagagaattccaggaaataacaaatccttttttaagttt
aggactggtcttccacttagcacctactttagtgcagtgaaacttcggtggcttttggat
aatgtggaagagatcaggcaagcagttgatgatggaagagcaatgtttggaactattgat
tcatggctcatatggtgtttgacaggtgggaagaatggaggtgttcactgtacagatgta
actaatgccagtagaacgatgttgttcaacattcattccttggattgggatcctgagctc
tgccaattctttgatattcctatggaaatacttccaaaagtacgaagctcatctgagatt
tatggcctgatgaaatctggagctttgacaggtgtgccaatttctgggtgcttgggtgac
cagtctgctgctcttgttgggcagatgtgcttccaagatggacaggcaaaaaacacgtat
gggacaggatgtttcttgctgtgcaatacaggccagaagtctgtgttttctgaccacggt
cttctaaccacgatagcttacaaactgggcagagacaaacctgtttgttatgcattagaa
ggatctgttgcaatagctggtgctgttgttcgttggctgagggacaatctaggtattgtt
aaaacttcacaggaagttgaaaaactggctgcagaagcgggaacttcttatggctgctac
tttgtgccagcattttcaggactgtatgcaccttactgggaacccagtgcaaggggtatt
atttgtggccttacccagtttacaaacaaaaaccacattgcctttgctgcactagaagca
gtctgcttccaaacacgagagattttagatgcaatgaacaaggactgcgggataccatta
agtcagttgcaagtagatggaggaatgaccaataacaaagttctcatgcaactccaatca
gacatcctctgtattccagtagtgaagccatcaatgcctgaaacaacagctctaggagct
gctatggcagcaggagctgcagaaggagttggaatttggagtctgaatcctggagatttg
acagcagtgacgtgtgaacgatttgaaccacagatcaacccagaggaaagtgaatatcgc
tatgccagatggaagaaagctgtgatgaaatctatgggctgggaaacatctgaagctcct
tcaaatggtgacactagtatcttctgtagtctgcctttgggtttttttattatgagtagc
atgataatgttaatcggagcaaagtacgtctcaggtacagataaatga

DBGET integrated database retrieval system