KEGG   Gallus gallus (chicken): 418589Help
Entry
418589            CDS       T01006                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gga00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:gga03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 555 aa AA seqDB search
MAASDRMVLGPLVGSIDQGTSSSRFLVFNAKTAELLSHHQVEIQQKFPKEGWVEQDPKEI
LRSVHECVERTCEKLQQLNIDITNIKAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQ
STVERLLKRIPGNNKSFFKFRTGLPLSTYFSAVKLRWLLDNVEEIRQAVDDGRAMFGTID
SWLIWCLTGGKNGGVHCTDVTNASRTMLFNIHSLDWDPELCQFFDIPMEILPKVRSSSEI
YGLMKSGALTGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGQKSVFSDHG
LLTTIAYKLGRDKPVCYALEGSVAIAGAVVRWLRDNLGIVKTSQEVEKLAAEAGTSYGCY
FVPAFSGLYAPYWEPSARGIICGLTQFTNKNHIAFAALEAVCFQTREILDAMNKDCGIPL
SQLQVDGGMTNNKVLMQLQSDILCIPVVKPSMPETTALGAAMAAGAAEGVGIWSLNPGDL
TAVTCERFEPQINPEESEYRYARWKKAVMKSMGWETSEAPSNGDTSIFCSLPLGFFIMSS
MIMLIGAKYVSGTDK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtcggaccgcatggtgctggggccgctggtgggctccatcgatcagggtacc
agttccagccgcttcctggtatttaatgcaaaaacagcagagctcctgagtcaccatcaa
gttgagatacagcagaaattccctaaggaaggatgggtggaacaagatccaaaggaaatc
ttaaggtcagtccatgaatgtgtggaaagaacctgtgagaaactgcagcaactgaacata
gacatcactaacataaaagccattggagttagcaaccagagggaaacaacagtggtttgg
gacaagacgaccggagaacctctttataatgctattgtgtggcttgacctaagaactcag
tcaacagttgaaaggcttcttaagagaattccaggaaataacaaatccttttttaagttt
aggactggtcttccacttagcacctactttagtgcagtgaaacttcggtggcttttggat
aatgtggaagagatcaggcaagcagttgatgatggaagagcaatgtttggaactattgat
tcatggctcatatggtgtttgacaggtgggaagaatggaggtgttcactgtacagatgta
actaatgccagtagaacgatgttgttcaacattcattccttggattgggatcctgagctc
tgccaattctttgatattcctatggaaatacttccaaaagtacgaagctcatctgagatt
tatggcctgatgaaatctggagctttgacaggtgtgccaatttctgggtgcttgggtgac
cagtctgctgctcttgttgggcagatgtgcttccaagatggacaggcaaaaaacacgtat
gggacaggatgtttcttgctgtgcaatacaggccagaagtctgtgttttctgaccacggt
cttctaaccacgatagcttacaaactgggcagagacaaacctgtttgttatgcattagaa
ggatctgttgcaatagctggtgctgttgttcgttggctgagggacaatctaggtattgtt
aaaacttcacaggaagttgaaaaactggctgcagaagcgggaacttcttatggctgctac
tttgtgccagcattttcaggactgtatgcaccttactgggaacccagtgcaaggggtatt
atttgtggccttacccagtttacaaacaaaaaccacattgcctttgctgcactagaagca
gtctgcttccaaacacgagagattttagatgcaatgaacaaggactgcgggataccatta
agtcagttgcaagtagatggaggaatgaccaataacaaagttctcatgcaactccaatca
gacatcctctgtattccagtagtgaagccatcaatgcctgaaacaacagctctaggagct
gctatggcagcaggagctgcagaaggagttggaatttggagtctgaatcctggagatttg
acagcagtgacgtgtgaacgatttgaaccacagatcaacccagaggaaagtgaatatcgc
tatgccagatggaagaaagctgtgatgaaatctatgggctgggaaacatctgaagctcct
tcaaatggtgacactagtatcttctgtagtctgcctttgggtttttttattatgagtagc
atgataatgttaatcggagcaaagtacgtctcaggtacagataaatga

DBGET integrated database retrieval system