KEGG   Gallus gallus (chicken): 418656Help
Entry
418656            CDS       T01006                                 

Gene name
PRKX
Definition
protein kinase, X-linked
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    418656 (PRKX)
   04310 Wnt signaling pathway
    418656 (PRKX)
   04340 Hedgehog signaling pathway
    418656 (PRKX)
   04020 Calcium signaling pathway
    418656 (PRKX)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    418656 (PRKX)
   04210 Apoptosis
    418656 (PRKX)
  Cell communication
   04540 Gap junction
    418656 (PRKX)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    418656 (PRKX)
   04912 GnRH signaling pathway
    418656 (PRKX)
   04914 Progesterone-mediated oocyte maturation
    418656 (PRKX)
   04916 Melanogenesis
    418656 (PRKX)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    418656 (PRKX)
   04270 Vascular smooth muscle contraction
    418656 (PRKX)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     418656 (PRKX)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   418656 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 468 aa AA seqDB search
MVMVKICFNKICEENYEFMGSKNDAFRGYSNAQPSDTLEWGVLEVLQRARDWQSLPGTDN
SKAGGGAGVWAVNGRQVPLGQPPSRTRTHPRRALCRPALWYGHSAGIAGALGATCDSALQ
PRSAPPGSAVCGQCGRPPVQSCFGWLSCIWVHRDGNSSFKYSRRTGTGTFGRVHLVKEKM
GKHYFPLKVMSIPNVIRLKQEQHVHNEKSVLKEVNHPFLIRLFWTYHDERFLYMLMEYVP
GGELFSYLRNMGRFNNSTGLFYSTEIICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTD
FGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPF
GIYQKILAGKIDFPRHLDLYVKDLIKKLLVVDRTRRLGNMKNGADDVKRHRWFRSIDWDA
VPQRRLKPPIVPKVSNDGDTSNFEAYPEDDWNKMPPVPPKDLEIFKNF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggtaaagatatgctttaacaagatttgtgaggaaaattatgaatttatgggg
agcaaaaacgatgctttcagaggttacagtaatgcacagccttctgacacgcttgagtgg
ggagtgcttgaggttctccagcgcgctcgggactggcaaagccttcctggcaccgacaac
tccaaggcaggcggcggggcgggagtttgggccgttaacgggcgacaggtgccgctgggg
cagcccccttctcgcacacgcacacatccgcggcgggcgttgtgccgcccggcattgtgg
tacgggcacagcgcgggcattgcgggcgcgttgggcgcgacgtgcgattcggctctgcag
ccgaggagcgctccgcccggctcggccgtctgcgggcagtgcggccgccctccggtacag
agctgcttcggctggcttagctgcatttgggtgcatcgggatggaaattcatcatttaaa
tacagtcgtaggaccggcacaggtacatttgggcgtgttcacctggtgaaggaaaaaatg
ggaaagcattacttcccactgaaagtaatgagcattccaaatgtcattcgactgaagcaa
gagcagcacgtgcacaatgaaaagtcagttttgaaagaggtcaatcacccatttttgatc
agattattctggacctaccatgatgaacgttttttatacatgttaatggaatatgtacca
ggaggagaactttttagctacctgcgcaacatggggcgtttcaacaacagcacaggactg
ttttactccacagaaattatttgtgcaatagaatacctgcactccaaagaaatagtttac
agagacttaaaacccgaaaatatattactagacaaagaaggacatatcaagcttactgat
tttggatttgctaaaaaattggtggatagaacatggacactttgtggcactcctgaatac
cttgcaccagaagtcatacaaagcaaaggtcatgggagagctgtggattggtgggccctg
ggaattcttatatttgagatgttgtcagggtttcctccattttttgatgacaatccattt
ggtatataccagaagattcttgctggcaaaatagatttcccacggcatttggatttgtat
gtaaaagaccttattaagaagctacttgtggttgacaggacaaggcgattaggaaatatg
aagaatggagcagatgatgtgaagagacatcgatggttcaggtctatagactgggacgct
gtacctcaaaggagactaaagcctcctatagtgccgaaagtatccaatgatggagatact
tccaattttgaagcttatcctgaagatgactggaacaaaatgcctccagtacctcctaaa
gatctagaaattttcaagaacttctga

DBGET integrated database retrieval system