KEGG   Gallus gallus (chicken): 418664Help
Entry
418664            CDS       T01006                                 

Gene name
AKAP17A, SFRS17A
Definition
(RefSeq) A-kinase anchoring protein 17A
  KO
K13169  
splicing factor, arginine/serine-rich 17
Organism
gga  Gallus gallus (chicken)
Brite
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR proteins
    418664 (AKAP17A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 686 aa AA seqDB search
MAAATIVHDTSEAVELCAPCGLYLKPITKMTISVALPQLKQPGKSISNWEVMERLKGMVQ
THQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEYKID
FPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFAAKDSGSEKPSEEVLTKVFQK
FGEIRNVDIPMLDPYREEMTGRNFHTFSFGGHLNFEAYVQYREYAGFIKAMNALRGMKLM
FKGDDGKAVACNIKVSFDSTKHLSDASIKKRQLERQKLQELEKQREEQKRREKEAEEKQR
EEERKQRELEEYERERKREEKLRKREQKQKDREVRRNKKQLEKLQAEEQKKLQEKIKLEE
RKLLLAQRNLQSIRLIAELLSRAKTVKLLEQEQNEEKIRLQQLEEKRKLQEAELRRVEEE
KERALGLQRKEKELREKLLNNLLSKKMDAVHQSKEETEASQSGTVKTASDVPHTVSSNCI
TSTSGQAVTGKLASDSQRELPSPENVNTQCKYLNGNIHDRVDVKEGQKLHTADSDRCSEK
RSSGVLSCVPANNQQQNTCRKDSRCEQGKHSTEPRRRKSRSCSSINTDESKGKRERSRHR
RDASYQDERRRRERRYYRHSSRSYSPRRSHSPRRRSVSPRRSHYRRTRSSERKRDRREKS
RSRRSSSRKRRYRRRSLSKQRSTWSG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcaacgatagttcatgatacatcagaagctgtagagctctgtgctccctgt
gggttataccttaaacccattacaaaaatgaccatcagtgtggcacttcctcagctgaaa
caacccggaaagtccatttcgaactgggaagtgatggaaagactgaaagggatggtgcaa
acccatcagttttccactctgcggatttccaaaagcacgatggatttcatccggttcgaa
ggagaggtggaaaacaaaagtttagtcaagtcttttcttgcgtgccttgatggcaaaacg
atcaagctgagtggcttctctgacattctgaaagtccgtgccgcagaatacaagattgac
tttcctaccaggcatgactgggactcatttttccgtgatgcaaaagatatgaatgaaact
ttgccaggggagaggccggataccattcatctagaaggcttaccttgtaaatggtttgca
gcgaaggactctggctcagaaaagccaagtgaagaagtccttacaaaagttttccagaaa
tttggagaaatacgtaacgtggacatacccatgctggacccttacagagaagaaatgact
ggcagaaatttccacactttcagctttggaggccatttgaattttgaagcttatgttcag
tatcgggagtatgcaggtttcattaaagccatgaatgccctgcgagggatgaagctgatg
tttaaaggcgatgatggcaaggctgtggcttgcaatataaaggtttcttttgactcaaca
aaacacctcagtgatgcatcaattaagaagcgtcagcttgaaaggcagaagcttcaggag
cttgaaaagcagagagaagaacagaaacgccgggagaaggaagctgaggaaaaacaaaga
gaggaagaaaggaagcagagagaacttgaagaatatgagagagagagaaagagggaagaa
aaattgcgcaagagagaacagaagcagaaagatcgtgaagttcgacgaaacaaaaagcag
cttgagaaacttcaagctgaagagcagaagaaacttcaagagaagataaagttagaagaa
aggaagctcctgttggctcagagaaatcttcagtccattaggctaattgcagaactgcta
agcagggcaaagacagtaaagcttttggaacaagaacagaatgaagaaaagatccgcctt
cagcaactagaggagaaacgaaagcttcaggaggctgagctcagacgtgtggaagaagaa
aaggaaagagcactggggttgcaaagaaaagaaaaagaactgagggagaaactactgaac
aatcttcttagcaagaaaatggatgcagttcatcagagcaaagaagaaacggaagcatct
cagtctggcactgtgaaaactgccagtgatgttccacacactgtgtcatccaactgcatc
acttctacctcaggacaggctgttacaggcaaactggcatcagactctcaaagagaacta
ccatcccctgagaatgtaaatactcaatgcaagtatttgaatggcaatattcatgacaga
gttgatgtcaaagaaggtcagaaacttcataccgcagactcggacaggtgttcagagaaa
agaagttctggtgtactctcatgtgttcctgccaataaccagcagcagaatacctgcagg
aaggactctcgctgtgagcaaggcaaacatagcacagagccaaggagaagaaagagccgt
tcatgtagcagcataaacactgatgagagtaagggtaaacgagagagaagcaggcacaga
agagatgcaagttaccaggatgaaagaaggaggagggaaaggaggtattatagacactct
agcagaagttacagtcctcgacgaagtcacagtcctcgtcgaagaagtgtaagccccaga
cgttcacattatagaagaactcgcagtagtgaacgtaaacgagacagaagagaaaaaagt
cgtagtcgcagaagctcaagcagaaaacgaaggtaccggaggagatcactgagtaagcaa
aggagtacttggagtgggtag

DBGET integrated database retrieval system