KEGG   Gallus gallus (chicken): 419175Help
Entry
419175            CDS       T01006                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C, gamma 1
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    419175 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    419175 (PLCG1)
   04370 VEGF signaling pathway
    419175 (PLCG1)
   04020 Calcium signaling pathway
    419175 (PLCG1)
   04070 Phosphatidylinositol signaling system
    419175 (PLCG1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    419175 (PLCG1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     419175 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
20
AA seq 1294 aa AA seqDB search
MIHAWVRLKRGAAPRPQLCACRGGGSPIRGRSPTHGRPTEPSPEPRIGAPRALPAGALST
PPPPTRDPAARVVAQTPPPHSTRTSRTPGGPNPRTHPRAAPRLLPTPPAPRGPHAWRRRP
SAALRPFAPPPPPPAAPGRGAGGSGRGGGGAAGAPLPFVRGAARCGRRALMAAGPGAPSE
AEAAHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQVTWSRGSEKTEGAVDIREIK
EIRPGKNSRDFDRYQEDPYFRPDQSHCFVVLYGTEFRLKTLSLQATSEDEVNMWIKGLNW
LVADTLRAATPLQIERWLRKQFYSLDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLT
DMEQRNGDITYGQFAQLYRSLMFSAQKTMDVPFLDRGGERSEHFRVSLMEFQKFLLEYQR
ELWAADGLQVQEFMFNFLRDPLREIDEPYFSLDEFLTFLFSKENSIWNSQLDMVCPENMN
NPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHT
LTTKIKFSDVLVTIKEHAFVTSDFPVILSIEDHCSIAQQRNMAQNFKKVFGDMLLTKPVD
ISADGLPSPNQLKRKILIKHKKLAEGSAYEELPTSVMYSENDISNSIKNGILYLEDPINH
EWNPHYFVLTSSKIYYSGETTSDQGNEDEEEQKEVSNSTELHSTEKWFHGKLGAGRDGRH
IAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGSPKFFL
TDNLVFDSLYDLITHYQEVPLRCNEFEMRLTEPVPQTNAHESKEWYHANLTRAQAEHMLM
RVPRDGAFLVRKRSEPSSYAISFRAEGKIKHCRVQQEGQTVLLGNSEFESLVDLISYYEK
HPLYRKMKLRYPINEETLEKIGTAEPDYGALYEGRHPGFYVEANPMPTFKCAVKALFDYK
AQREDELTFTKNAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEISSPNSLEPEREQQL
DENSPLGDLLGGVLDVPSCQIAIRPEGKNNRLFVFSISMASASRLSLDVAADTHEDLMDW
VKKIREAAQTADARLSEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSS
FPETKAEKYVNKIKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQT
PGESSGQGRGSSHAPCGKYRGEEGLAAPALCARSHWERTHRPTRKNDFHICFCWVSHCFC
ELKHLAGWFDKLKGEGGGEKGMTGGAQAPWAGCM
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgcgtgggtccgcctgaagcgcggagctgcacctcggccccagctctgtgcg
tgccgcgggggcggcagccccattcgcggccgctcccccacccacgggaggcccacggag
ccgagcccggagccgcgcattggagcgccccgggccctcccggctggggcactcagcacc
ccgccgccgcccacccgcgaccccgcagcgcgcgtggtcgcacagacccctcccccgcac
tccacccggacgtcgcggacccccggcggccccaacccacgcacccacccgcgggccgcc
ccccgcctcctccccactccccccgcaccgcgcgggccccacgcgtggaggcgccgtcct
tcggccgcgctccgccccttcgctcctcctcctcctcctcccgcagctcccggccgcggg
gcgggcgggtcggggcgcggcggcggtggcgctgcgggcgctccgctcccctttgttcgc
ggcgcagcgcggtgcgggcggcgggcgctgatggcggcggggccgggggcgcccagcgag
gcggaggcggcgcacctctgccgcagcctggaggtgggcaccgtcatgaccctcttctac
tccaaaaagtcgcagcggcccgagaggaaaactttccaggtgaagctggaaacgcggcag
gtcacctggagccgcggctccgagaagaccgagggagccgtggatattcgtgaaatcaaa
gagattcgtcctggaaagaattcccgtgactttgaccggtaccaggaggatccgtacttc
cgacccgaccagtcccactgcttcgtggtcctctatggcacagagttcaggctgaagacc
ctcagcttgcaagccacgtccgaggatgaggtcaacatgtggatcaagggactgaactgg
ctggtggcagatactctgagggctgccacccccctgcagatcgaaaggtggctccggaag
cagttctactcactggaccggaaccgggaggacaggatctctgccaaggacctgaagaac
atgctgtcccaggtcaactaccgcgtgcccaacatgaggttcctgcgggagcgcctgacg
gacatggagcagaggaatggggatatcacgtacgggcagtttgcacagctctaccgcagc
ctgatgttcagtgcccagaaaacgatggacgtcccattcctagataggggtggagaaagg
tccgagcacttcagggtgtcgctgatggagttccagaagttcctgctcgagtaccagagg
gagctctgggctgcagacggccttcaggtacaggaattcatgttcaacttcctgagagac
cctttgagagagatcgacgagccttatttctccctcgatgagtttctcaccttcctgttt
tccaaagagaacagcatctggaactcgcagctggacatggtgtgtcccgagaacatgaac
aaccccctgtcccattactggatctcctcctcacacaacacgtacctgacgggggatcag
ttctccagtgagtcctcgctggaggcgtacgcccgctgcctgcgcatggggtgccgctgt
atcgagctggattgctgggacggtcctgatggtatgccggtcatctaccatgggcacacc
ttaaccaccaagatcaagttctctgacgtcttggtcaccatcaaggagcacgcctttgtc
acctctgatttccctgtcattctgtccattgaggaccactgcagcatcgctcagcagagg
aacatggctcagaatttcaagaaggtctttggggacatgctcctgaccaaacccgtagat
atttctgctgacgggctcccctctccaaaccaactcaagaggaagattctcatcaagcac
aagaagctggcagagggcagtgcttacgaggagctgcccacttctgttatgtactcagag
aacgacatcagcaactccatcaagaacgggatcctctacctggaagaccccatcaatcac
gagtggaacccacattattttgtcctgaccagcagcaagatctattactcgggggagacg
accagtgaccagggaaatgaggatgaggaggagcagaaggaggtgagcaacagcaccgag
ctgcactccacagagaagtggttccacggcaagctgggagcagggcgcgacgggcggcac
attgctgagcggctgctgacagagtactgcatcgagacgggggcccctgacggctccttc
ctcgtcagggagagcgagaccttcgttggggactacactctgtccttctggcgcaatggg
aaggtgcagcactgccgcatccactcgcggcaggacgccggcagccccaagttcttcctg
acagacaacctggtgtttgacagcctctacgacctcatcacccactaccaggaggtgccg
ctcaggtgcaatgagtttgagatgaggctgacagagccggtgcctcagaccaacgcccat
gagagcaaagagtggtaccacgccaacctcactcgtgcccaagctgagcacatgctgatg
cgggtgccacgggatggagccttcctggtgcgcaagaggagcgagcccagctcctatgcc
atctccttcagagcggaagggaagatcaagcactgccgtgtgcagcaggagggccagacc
gtgctgctgggcaactctgagttcgagagcctggtggacttgatcagctactatgagaag
cacccgctgtaccgcaagatgaagctgaggtaccccatcaacgaggagacgctggagaag
atagggacagcggagccggactacggagcgctctatgaggggcgccatcctggcttctac
gtggaggccaaccccatgccaaccttcaagtgtgcagtcaaagctctgtttgactacaag
gcgcagcgagaggatgagctcaccttcaccaaaaatgccatcatccagaacgtggagaag
caggaaggaggctggtggaggggagattacggtggcaagaagcagctgtggttcccttcc
aactacgtggaggagatcagcagtcccaacagcctggagccggagcgggagcagcagctg
gatgagaacagccccctgggagacctgctgggaggtgtcctggatgtgccgtcttgccag
atcgccatccgccccgagggaaagaacaaccgcctgttcgtcttctccattagcatggcc
tcagcgtcacgcttgtcccttgatgtggctgctgatacacatgaggacttgatggactgg
gtgaagaagatccgggaggcagcccagacggctgatgcacggctctctgaagggaagatg
atggagaggaggaagaagatcgccttggagctttcagagctagtggtctattgccgaccc
gtgcccttcgatgaagagaagatcggcacggagagggcctgttaccgagacatgtcctcc
ttccctgagaccaaggcagagaagtacgtcaacaagatcaagggcaagaagttcctgcag
tacaaccggcgccagctcagccgcatctaccccaaagggcagcgcctggactcctccaac
tacgacccactgcctatgtggatctgcggcagccagctggtggccctcaacttccagaca
cccggtgagagcagcgggcaggggagggggtcctcacatgcaccctgtggcaaatacagg
ggcgaggagggtcttgcagcccccgctctgtgtgccaggtcccactgggagcgcactcat
agacccaccagaaaaaatgactttcatatttgtttctgctgggtttcccattgcttttgt
gaattgaagcatcttgcaggttggtttgacaagctgaaaggagagggagggggcgaaaag
gggatgactggtggagcacaggccccctgggcaggatgcatgtga

DBGET integrated database retrieval system