KEGG   Gallus gallus (chicken): 419208Help
Entry
419208            CDS       T01006                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     419208 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
20
AA seq 1405 aa AA seqDB search
MVRMSGLGESSLDSLTNESRKRKPLPCDTPGASLTCSGEKRRREQESKYIEELAELISAN
LSDIDNFNVKPDKCAILKETVRQIRQIKEQGKAVSNDDEVQKADVSSTGQGVIDKDSLGP
LLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYGILHEEDRKDFLKNLPK
SSVNGVAWTNDAPRQKSHTFNCRMMVKTSHDLLEDVGSHQDTRQRYETMQCFALSQPRAM
MEEGEDLQSCMICVARRIATAERVFPTNPESFITRHDLSGKLVNIDTNSLRSSMRPGFED
TIRRCIQRFLCHNDGQSWSNKRHYHEAYTQGHAETPLYRFSLADGTIVTAQTKSKVFRNP
VTNDRHGFVSTHFLQREQNGYRPNPNTVGQNIRTTVAGNTNSVGLMNMSPGQGMPMQNRN
YGMGDPSTVGQLNSSRYGGPGNMGPVNSGPGMQSSAYQSNSYGLNISSPPHGSPGLTSNQ
QNLMISTRNRGSPKMNSHQFSPVTGMHSPMGSASNTSNSTFSSSSLSALQAISEGVGTSL
LSTLSSPGPKLDSSPNVSIAQQNKANNQDSKSPSGLYCEQNQVESSICQSNSRDVLSEKD
SKDGSLDASESQRGQSESKGHKKLLQLLTCSSDERGHSTASNSPLDSNCKESSTNVTSPS
GVSSSTSGGVSSSSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTYHDTSNT
VPCGESTVKQEQLSPKKKENNALLRYLLDKDDVKDPLSKELKPKVENVDNKMGQCSSSTI
PTSSQEKEMKIKTEPTEEMSGDLDNLDAILGDLTSSDFYNNAMSTSGNNFGMKQALFQGN
ASLTGMRSPQSVQAARPPFNRAMSLDSPVGSGASVRNVNAFSMLQKQNLMGGSPRMTENQ
ESFGANIASTPNRGVSMNQHQSGDWGLPNSKVNRLEPTSSTSMLRQGAEFSASLPRPTAG
GSMPGLPVRSNSIPGTRPMLQQQMMHMRSNEINIGMGGNPYGQTGPTSQPGSWPDSMLSM
EQASRGLQNRQLVRNSLDDLLSAAPSVEGQNDERALLDQLHTLLSNTDVTSLEEIDRALG
IPDLVNQGQTLEPKQDSFQGQESTVMMDQKPSLYGQPYQGQGTALPGGFNNIQGQQPSFN
SVMNQMSQQNNFPLQSMHPRANAMRPRTNTPKQLRMQLQQRLQGQQFMNQTRQALEMKME
NPGSSNSSVMRPVMQPQVGSQQQGFLNAQMVAQRNRELISHHFRQQRMAMMMQQQQPQAF
SPPPNVTASGSMDSGLTGPPMAQVPPQQFSYPPNYGISQQPDPAYSRVSSPPNPMMASRI
GPSQNPMMQHPQTAPMYQSPEMKGWPSGSMARSSSFPQQQFSHQGNPATYSMMHMNGSSG
HIGQMNITTVPMSGMPMGPDQVSCT
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggtcaggatgagtggattaggagaaagctccttggatagcttgaccaatgagtcaagg
aaacgcaagccgttgccctgtgatactccaggtgcaagtctgacctgcagtggtgagaag
cgtcgacgtgagcaggaaagcaaatacattgaagaactggctgaactgatatctgctaat
ctgagtgacattgacaatttcaatgtcaaaccagacaaatgtgctattttaaaagaaact
gtgagacagattcgacagataaaagagcaaggaaaggcagtttccaatgatgatgaggtt
cagaaagctgatgtgtcttccacaggtcaaggagttattgataaggactccttaggacct
cttttactacaggcattggacggtttcctgttcgttgtcaatcgtgatgggaacatagta
tttgtgtcagaaaatgtcacacagtatttgcaatataaacaggaagatttggttaataca
agtgtctatggtatcttgcacgaagaggaccggaaggacttccttaaaaacttacctaaa
tcttcagttaatggagttgcttggaccaatgatgcacctagacagaagagtcatacattt
aattgtcggatgatggtgaaaacttcccatgatcttttggaagatgtaggcagccaccag
gatacacgccagagatatgaaacaatgcagtgctttgctttatctcagccaagggctatg
atggaagagggggaagatttacagtcctgtatgatttgtgtggcacgtcgtatcgcaact
gcagaaagagtatttccaacaaatccagagagcttcattaccagacatgatctttcaggc
aaacttgtcaacatcgacacaaactcattacgatcttccatgagacctggctttgaggat
acaattcgacggtgtattcagaggtttttatgccataacgatggacagtcctggtcaaac
aaacgccactatcatgaagcttatacacaaggtcatgctgaaacaccattgtatcgcttt
tccttagcggatggaactatagtgacagcacaaacaaagagtaaagtgtttagaaatcca
gtaactaatgaccgccatggatttgtctctacccactttcttcaaagagagcaaaatgga
tatcgaccgaatcctaatacagttgggcaaaacatcagaacaacagtggctggaaataca
aattctgttggtcttatgaacatgtcacctggtcaaggcatgccaatgcaaaacaggaac
tatggcatgggagatcccagtacagtgggccagctgaacagctctcgatatggaggccct
ggtaatatgggaccagtgaactctggaccaggaatgcagtcctctgcttatcagagcaat
agttatgggttaaatataagtagcccaccacatggaagtcctggtttaacttccaaccaa
cagaatctaatgatatctactaggaatcgagggagtccaaaaatgaattcacaccagttt
tctccagttacaggtatgcactctccaatgggatctgccagcaacaccagcaacagcact
ttctctagcagttctcttagtgctcttcaagccattagtgagggggttggaacttccctt
ttatcaacactttcttcaccaggtccaaaattggatagttctccaaatgtgagcatagct
cagcaaaataaagcaaataaccaggactccaaaagcccatcaggcttgtattgtgaacaa
aatcaggtggaaagttccatctgccaatcaaacagcagggatgtccttagtgaaaaggat
agtaaagacggaagtctggatgcatctgaaagccagagaggacaatctgaaagcaaaggg
cataaaaagctgcttcagctactcacatgctcttcagatgaaagaggacattctacagca
tcgaactcacctttagactctaattgtaaagaatcttctaccaacgttaccagtccttca
ggagtttcctcatcaacatctggaggggtgtcttcctcctcaaatgtgcatgggtcactc
ctgcaagagaaacataggattttacataaattgttgcaaaatggtaattcccctgcagag
gttgccaaaataacagctgaagctactggtaaagacacatatcatgacactagtaataca
gtcccatgtggagaaagtacagtcaaacaggaacaactgagcccaaagaagaaagaaaac
aatgctttactaagatacctgttagataaagatgatgttaaggatccgctttccaaagag
ttgaagccaaaagtggaaaatgtggataataaaatgggacaatgcagtagttctactatt
cctacttccagtcaagaaaaggagatgaaaataaaaacagaaccaacggaggagatgagt
ggagacttggataatttggatgcaattttaggggatctgactagttcagacttctataat
aatgctatgtctacaagtggaaataactttggaatgaagcaagcgttatttcaaggaaat
gcttcactgacaggtatgaggagtccccagtctgtgcaggctgcccgcccacctttcaac
agagccatgtctttagacagccctgtgggctcaggtgcttcagtgaggaatgtcaatgca
ttctccatgttacaaaagcaaaacttgatgggtggaagtccaagaatgactgaaaaccag
gaaagcttcggagcaaatattgcaagtactcccaacagaggtgtatctatgaatcaacat
caatcaggagactggggtttgccaaactcaaaggttaacagattggaacctacaagttct
acttccatgttgagacaaggagctgagttcagtgcatcccttcccagacccacagcaggt
ggctctatgcctgggctgcccgtccgttctaacagcatccctgggacaagaccaatgcta
caacagcaaatgatgcatatgagatcaaatgagattaacattggtatgggggggaatcct
tacggacagacaggaccaaccagccagccaggatcgtggcctgacagcatgctgtccatg
gagcaagcatcacggggtttacaaaacagacaattagtgagaaactctttggatgacctc
ttaagtgcagcaccaagtgtggaaggccagaatgatgaaagggctcttttggatcagctg
cacacattgctgagtaatacggatgtcacaagcctggaagaaattgacagagctctagga
attcccgatcttgtaaaccaagggcaaactttggaacccaaacaagattcatttcaaggt
caggaatccacagtgatgatggaccaaaagccttcgttatatggtcagccctaccaaggg
cagggcacagccttgccaggaggctttaataacatccagggacagcagccatcctttaat
tccgtgatgaatcagatgagccaacaaaacaattttccacttcaaagtatgcatcctaga
gcaaatgcaatgagacctcggaccaatacaccaaagcagctccgcatgcagctccagcag
aggcttcaggggcagcagtttatgaatcaaacccgtcaagcgcttgaaatgaagatggag
aatccaggcagtagtaatagctcagtgatgagaccagtaatgcagccacaggtgggatca
cagcagcaaggttttcttaatgctcaaatggtggctcagcgtaacagggagctaataagt
catcattttagacaacagaggatggcaatgatgatgcagcagcaacaacctcaggccttc
agtccaccaccaaatgtgactgcctcaggaagcatggatagtggtctgaccggccctcca
atggctcaagttcctccacagcaattctcctatccacctaattatggaataagccaacag
cctgaccctgcatatagtagagtatcaagccctcccaatccaatgatggcatcaagaatt
ggaccttcccagaatcctatgatgcagcatcctcagacagcaccaatgtaccagtctcct
gagatgaagggctggccgtcggggagcatggccaggagcagttctttcccacagcaacag
ttcagccatcaaggtaatcctgcaacgtacagtatgatgcacatgaatggcagcagtggc
catattggacagatgaacattactactgtgcctatgtcagggatgcctatgggtccagac
caggtaagctgtacataa

DBGET integrated database retrieval system