KEGG   Gallus gallus (chicken): 419324Help
Entry
419324            CDS       T01006                                 

Gene name
RAE1
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:gga03013]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
20
AA seq 368 aa AA seqDB search
MSLFGSTSGFGTGGTSMFGSTTADNHNPMKDIEVTSPPDDSISCLAFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDGCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSPTPMMTLQLPERCYCADVVH
PMAAVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKVNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttgggtccacgtccgggttcggtaccggtggtaccagcatgttcggcagc
acgactgcggataatcacaacccaatgaaggatattgaagtaacatctccacctgatgac
agcatatcttgtttagcattcagtccaccaacgctaccaggcaatttccttatcgcagga
tcgtgggcaaatgatgttcgttgctgggaagttcaagataacggacagacgattccaaag
gctcagcagatgcacacagggcctgtactagatggctgctggagtgatgatggaagtaaa
gtatttactgcttcctgtgataaaactgccaaaatgtgggatctcaacagtaatcaggct
attcagattgcacaacatgacgctcccgtgaagaccatccattggattaaagcacccaat
tacagctgtgtgatgacaggaagctgggataaaactttaaagttctgggatacccgttca
ccaacgcctatgatgacattgcagctccctgaaagatgttactgtgcagatgtggttcat
cctatggctgctgtggccactgcagaaaggggtttgatagtttatcagctagagaaccaa
ccctctgaatttagaagaatagaatcacctcttaaacaccagcatcgctgcgttgctatt
tttaaagacaaagtgaacaaacctactggatttgcccttggaagtattgaaggaagagta
gctattcattatatcaaccctccaaaccctgcaaaagataatttcactttcaaatgtcat
cgctccaatggaacaaacacgtcagcacctcaggatatctatgctgtaaatggaatagca
ttccatcctgtccatggtactcttgcaacagtgggatctgatggtagattcagcttttgg
gataaagatgcacgaacaaagctaaaaacatcagaacaacttgaccaaccaatatctgct
tgttgtttcaaccataatgggaatatatttgcatatgcttccagttacgattggtcaaag
ggtcatgaattttataatccacaaaagaaaaactacatttttctgcgaaatgcagcagaa
gagttaaagcctcggaataagaagtag

DBGET integrated database retrieval system