KEGG   Gallus gallus (chicken): 419455Help
Entry
419455            CDS       T01006                                 

Gene name
MTOR, FRAP1
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
gga  Gallus gallus (chicken)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:gga04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:gga04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYNAHQGIMGFATSPMPAKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQSRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDAPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLASGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSASQSVEMLDGMELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcactgtgtctattctccaacaatttgccaatggcttgaagagtcgcagtgaa
gaaacaagggcgaaagctgccaaggacctgcagcattatgtcaccatggagctccgtgaa
atgagccaggaggagtccaccaggttttatgatcagctgaaccatcacatttttgaactg
gtctctagctctgatgcaaatgaaaggaagggtggcattttggctatagcaagccttatt
ggtgttgaaggaggtaacgccacccgtatcggcaggtttgcaaactatctgaggaacctt
ttgccatccaatgatcctgttgtaatggaaatggcttccaaggctatcgggcggcttgca
atggctggtgacaccttcacagctgagtatgtggagtttgaggtgaaacgtgctctggaa
tggctgggggctgacaggaatgaaggtcgaagacatgcagctgttcttgtactgcgtgag
ctggcaatcagtgtgcctaccttcttcttccaacaagtgcagccattctttgacaatatt
tttgtggctgtgtgggatcccaagcaggccattcgagagggagccgtttctgccttaaga
gcctgccttatcctcaccactcagcgggaaccaaaagaaatgcagaaacctcagtggtac
agacatacatatgaagaggctgagaagggttttgatgaaactttggccaaggagaaagga
atgaaccgtgatgaccgaatccatggtgccttattgatcctcaatgagctcgtgaggatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctc
gtgcatgacaagtactgcaaagacctgatgggctttagtaccaaacctcgccacatcact
cccttcactagcttccagtctcttcagccctctcagtcaaatgctttggctggtcttctg
ggttacaatgcccaccaaggaatcatgggttttgcaacgtcacctatgccggcaaagtct
acgttggtagaaagtcgatgctgcagagatctaatggaggagaagtttgatcaggtgtgc
cagtgggttcttaagtgcagaaccagcaaaaattctttgatccagatgacagttctcaat
ctgctaccacggctggcagctttccgtccttcagcattcacagctgatcagtatcttccg
gacaccatgaaccatgttctcagctgtgtgaagaaggagaaggagagaacagcagccttc
caggccttgggtttgctttctgtggctgtcagatctgagtttcaagcctacctgccaaaa
gtccttgaaataataaaagcagctcttccaccaaaggactttgctcacaagaggcagaag
tctgtgcaggttgatgctacagtcttcacctgcattagtatgttggcacgagccatgggg
ccaagtatccagcaggacattaaagagcttctggaacctatgctggccgtgggtctgagc
cctgctctaacagctgtgctatacgacttgagtcgtcagatccctcagctaaagaaggat
atccaggatgggctgctgaaaatgctttcccttgttttaatgcacaaacctctgcgacat
ccaggcatgccaaaaggtcttgcccaccaactggcctcccctagcctcaccaacatcccg
gaggccagtgatgtgggtagcatcacacttgccctacgtacgctgggcagctttgagttt
gaagggcattctctgactcagtttgtccggcattgtgcagaccactttctgaacagtgag
cacaaggagatacggatggaagcagcccgcacttgttctcgcttgctcacgccttccatc
cacttgatcagtggccatgcccacgtggtcagtcagacagcagtgcaggttgtggctgat
gttctcagcaaactgcttgtggttggaataacagacccagaccctgatatacgtttctgc
gtgttggcgtccctggatgagcgatttgatgctcaccttgcccaggcagaaaacttgcaa
gctctttttgtggccctgaatgatcaagtatttgaaatccgagagctggccatctgtact
gtgggtcgcctgagcagcatgaaccctgcctttgtcatgcctttcctgcgcaagatgtta
atccagattctaacagaactagagcacagtggtgttggtaggattaaagagcaaagtgcc
aggatgttgggtcacttggtttctaacgctccacgtctcattcgtccatatatggagcct
atccttaaggcactgatagtgaaactgaaagatcctgatccagatccaaacccaggggtg
attaacaatgttctagctaccattggggaacttgcacaggtcagtgggctggagatgagg
aagtgggtggatgaactcttcattataattatggacatgctacaggactcttccctgctg
gctaaaagacaagtggctctttggacactgggtcagcttgtggctagcactggttatgtg
gtggaaccctacaggaagtacccaactttattggaggtgcttctgaacttcctaaagact
gagcagaaccagggcacccgtagagaggctattcgtgtgttagggctgctgggtgctttg
gacccctacaaacacaaggtgaacattggcatgattgatcagtcacgagatgcttctgct
gtcagcctctcggagtccaaatctagccaggattcttcggactacagtaccagtgagatg
ctggtgaacatgggaaacctccctctggatgaattctatccagctgtctctatggtggca
ctgatgagaattttccgagaccagtccttgtcccagcaccacactatggtggttcaggcc
atcacctttattttcaaatcccttggactgaagtgtgtgcagttcctgccccaggtcatg
ccaacgttccttaatgtaataagggtttgtgatggtgccatccgagagttcctgttccag
cagctggggatgttggtgtcctttgtgagaagtcacattcggccctatatggatgaaatt
gtcaccctcatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttattgagcaaattgtggtggctctaggaggcgagttcaagctctatctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaatagtcagagtcgaattgtctctgtc
aagctattgaatgcaatccagctctttggagctaacctggatgactaccttcatttatta
ctacctcccattgtaaagctgtttgatgccccagatgccccagtggtggctcgcaaagct
gctcttgaaacggtggaccgcttgacagagtctctggattttactgattatgcttcacgg
attattcatcccattgtgcgaacactagatcagagcccagagctacgaacaactgcaatg
gacactctctcctctctggtattccagctgggaaagaagtaccagatctttatcccgatg
gtaaacaaagttctggtgcgacacagaattaaccatcaacgctacgatgttcttatctgc
agaattgtaaagggctatactcttgctgatgaggaggaggatcccctcatttatcaacat
cggatgttgagaagcaaccagggagaaaccttggccagtggtcccgtggaaacaggtcct
atgaagaaattacatgttagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtctccaaagatgactggttggaatggttaagaagactcagtttggagctgctgaaagat
tcctcctcaccatccttgcgctcatgctgggccctggctcaggcatataatcctatggct
cgagatctcttcaatgctgcttttgtttcatgctggtctgaactgaatgaagaccagcag
gatgagctgatccgaagcattgaattggccctgacttctcaggacattgcagaggtcact
cagacactgctgaacttggcagaattcatggagcacagcgacaagggtccactgcctttg
agagatgataatggcattgtcctcctgggggagagagcagcaaaatgtcgagcatatgcc
aaggctcttcactacaaagagctggaatttcagaagggtcccactccagccattctagag
tctcttatcagcattaacaataaactgcaacagccagaagcagctgctggggtgctggaa
tatgccatgaagcactttggggagctggaaattcaagctacctggtatgaaaagcttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaagatgatcct
gagctgatgctgggacgaatgcgttgcttggaagcgcttggagaatggggccaactccac
cagcaatgctgtgaaaagtggacgcaggtcaatgatgaaactcaagctaagatggcaagg
atggctgctgctgctgcctggggtctaggtcagtgggacagcatggaagaatatacctgc
atgatcccaagggacacccacgatggtgccttctacagggctgtactggctcttcatcag
gaccttttctcactggctcagcagtgcattgacaaggccagagatctgctagatgccgag
ctgactgccatggcaggcgagagctatagtcgagcctatggggctatggtatcctgccag
atgctgtcggagctggaagaggttatccagtataaacttgtaccagaacgccgtgagatc
atccgccagatatggtgggaaagactgcagggctgtcaacggattgtggaagactggcaa
agaatattgatggttcggtctcttgttgtgaatcctcacgaggacatgagaacttggctt
aagtatgccagcttgtgtggcaagagtgggagactggctttggcccataagacacttgtc
ctgctcttgggagtagatccatcccgacagctggatcacccactgccaacagtacatccc
caagtgacttatgcatacatgaaacacatgtggaagagtgcccgtaagattgatgcattc
cagcatatgcagcactttgtacagacaatgcagcagcaggcacagcatgccattgccact
gaggaccagcagcacaagcaggagctccacaagcttatggcacggtgtttcctgaaactg
ggtgagtggcagctgaacctgcaaggcatcaacgagagtaccatccccaaagtcttacag
tactacagtgctgcaacagagcatgatcgtaactggtacaaggcctggcatgcctgggca
gtgatgaattttgaagcagtgcttcactacaagcatcagaaccaggccagagatgagaag
aagaaattgcgtcatgccagtggagccagtatcaccagtgccaacactgagggcagcaac
agtgagagtgatgcggagagcacagagaacagtcccatcccatctccagtgcagaaaaaa
gtcactgaggatttatccaagactctcttgatgtacactgtccccgctgtccaaggtttc
ttccggtccatatctctgtctcgaggaaacaacctacaagacactctcagagtacttact
ctatggtttgattatggtcactggcctgatgtgaatgaagctttggttgaaggggtcaag
gcaatccaaatagatacttggttgcaggttatccctcagcttattgcaagaattgacaca
cctcgaccattagtaggacgtctcattcatcagctcctcacagatattggacggtaccac
ccccaggctttgatctatcctttgactgtggcatctaaatccacaaccactgctcgccac
aatgctgcgaataaaatcttgaagaacatgtgtgagcacagtaacacgctggtgcagcag
gcaatgatggtaagtgaagagctaatccgtgtggcgatcctatggcatgagatgtggcat
gaagggttggaagaagcatctcgtctgtacttcggagaaagaaatgtgaagggaatgttt
gaggtgctggaaccacttcatgcaatgatggagcgtgggcctcagactttaaaagagaca
tccttcaatcaggcctatggcagagatctaatggaagctcaagagtggtgcaggaagtat
atgaaatcaggaaatgtcaaggacctaacccaggcttgggatctctactaccacgttttc
aggcgtatctcaaagcagctgcctcagctcacttctttggaactacagtacgtgtcacca
aaactcttaatgtgccgggacctggaattggcagtgccaggaacgtatgatcccaaccag
cccatcatccgcattcagtccattgcaccctcacttcaggtcatcacctccaagcagcgg
cccaggaaactaacattaatgggaagcaacgggcatgagtttgtgttccttctgaaaggt
catgaagaccttcgtcaagatgaaagagtgatgcagctttttgggttggtcaacactctg
ctagcaaacgacccaacttctcttcgtaaaaacctcagcatccagagatatgctgttatt
ccactgtccacaaattcaggcttaataggttgggtcccccactgtgacacactgcatgcc
ctcatccgcgactacagagagaagaaaaagatcctgctgaacattgaacatcgcatcatg
ctgaggatggctccagattatgaccacctgactttaatgcagaaggtagaagtatttgaa
catgctgtcaataacacagctggtgatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtatggtttgacagaagaacaaactacactcgttcactagctgtgatgtca
atggttgggtacattctgggtcttggggacagacacccttccaatctgatgttagacaga
ctgagtggaaaaatcctgcatatcgactttggggactgttttgaggttgcgatgacaaga
gagaagttccctgagaagattccatttaggttaacaaggatgctgacaaacgctatggag
gtgacgggccttgatggcaattacagaatcacctgtcacacagtgatggaagtcctgcgc
gagcataaggacagtgtcatggctgtgctagaagcctttgtatatgatccattattgaac
tggaggctgatggacacaaatacaaagggcaataaacgttcacgaacaagaacagactcc
tactcagccagtcagtcagtagaaatgttagatggtatggaactgggggagacagcccat
aagaaaactgggaccacagtgcctgaatccatccattccttcataggagatggcctcgtg
aagccggaagctctgaataagaaagcaattcaaattatcaacagagttcgagataaactc
actggtcgagacttctctcatgatgaaactcttgatgtacccacacaagtagaattgctc
attaagcaagctacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system