KEGG   Gallus gallus (chicken): 419455Help
Entry
419455            CDS       T01006                                 

Gene name
MTOR, FRAP1
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04136  Autophagy - other
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04218  Cellular senescence
gga04371  Apelin signaling pathway
gga04910  Insulin signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    419455 (MTOR)
   04371 Apelin signaling pathway
    419455 (MTOR)
   04150 mTOR signaling pathway
    419455 (MTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    419455 (MTOR)
   04136 Autophagy - other eukaryotes
    419455 (MTOR)
  Cell growth and death
   04218 Cellular senescence
    419455 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    419455 (MTOR)
   04920 Adipocytokine signaling pathway
    419455 (MTOR)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     419455 (MTOR)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   419455 (MTOR)
Membrane trafficking [BR:gga04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    419455 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD HEAT_EZ UME EPSP_synthase CFIA_Pcf11
Motif
Other DBs
NCBI-GeneID: 419455
NCBI-ProteinID: XP_417614
CGNC: 2430
Ensembl: ENSGALG00000003339
UniProt: F1NUX4
Position
21
AA seq 2521 aa AA seqDB search
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYNAHQGIMGFATSPMPAKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQSRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDAPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLASGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
FRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSASQSVEMLDGMELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcactgtgtctattctccaacaatttgccaatggcttgaagagtcgcagtgaa
gaaacaagggcgaaagctgccaaggacctgcagcattatgtcaccatggagctccgtgaa
atgagccaggaggagtccaccaggttttatgatcagctgaaccatcacatttttgaactg
gtctctagctctgatgcaaatgaaaggaagggtggcattttggctatagcaagccttatt
ggtgttgaaggaggtaacgccacccgtatcggcaggtttgcaaactatctgaggaacctt
ttgccatccaatgatcctgttgtaatggaaatggcttccaaggctatcgggcggcttgca
atggctggtgacaccttcacagctgagtatgtggagtttgaggtgaaacgtgctctggaa
tggctgggggctgacaggaatgaaggtcgaagacatgcagctgttcttgtactgcgtgag
ctggcaatcagtgtgcctaccttcttcttccaacaagtgcagccattctttgacaatatt
tttgtggctgtgtgggatcccaagcaggccattcgagagggagccgtttctgccttaaga
gcctgccttatcctcaccactcagcgggaaccaaaagaaatgcagaaacctcagtggtac
agacatacatatgaagaggctgagaagggttttgatgaaactttggccaaggagaaagga
atgaaccgtgatgaccgaatccatggtgccttattgatcctcaatgagctcgtgaggatc
agcagtatggagggagagcgccttagagaggagatggaggagatcactcagcagcagctc
gtgcatgacaagtactgcaaagacctgatgggctttagtaccaaacctcgccacatcact
cccttcactagcttccagtctcttcagccctctcagtcaaatgctttggctggtcttctg
ggttacaatgcccaccaaggaatcatgggttttgcaacgtcacctatgccggcaaagtct
acgttggtagaaagtcgatgctgcagagatctaatggaggagaagtttgatcaggtgtgc
cagtgggttcttaagtgcagaaccagcaaaaattctttgatccagatgacagttctcaat
ctgctaccacggctggcagctttccgtccttcagcattcacagctgatcagtatcttccg
gacaccatgaaccatgttctcagctgtgtgaagaaggagaaggagagaacagcagccttc
caggccttgggtttgctttctgtggctgtcagatctgagtttcaagcctacctgccaaaa
gtccttgaaataataaaagcagctcttccaccaaaggactttgctcacaagaggcagaag
tctgtgcaggttgatgctacagtcttcacctgcattagtatgttggcacgagccatgggg
ccaagtatccagcaggacattaaagagcttctggaacctatgctggccgtgggtctgagc
cctgctctaacagctgtgctatacgacttgagtcgtcagatccctcagctaaagaaggat
atccaggatgggctgctgaaaatgctttcccttgttttaatgcacaaacctctgcgacat
ccaggcatgccaaaaggtcttgcccaccaactggcctcccctagcctcaccaacatcccg
gaggccagtgatgtgggtagcatcacacttgccctacgtacgctgggcagctttgagttt
gaagggcattctctgactcagtttgtccggcattgtgcagaccactttctgaacagtgag
cacaaggagatacggatggaagcagcccgcacttgttctcgcttgctcacgccttccatc
cacttgatcagtggccatgcccacgtggtcagtcagacagcagtgcaggttgtggctgat
gttctcagcaaactgcttgtggttggaataacagacccagaccctgatatacgtttctgc
gtgttggcgtccctggatgagcgatttgatgctcaccttgcccaggcagaaaacttgcaa
gctctttttgtggccctgaatgatcaagtatttgaaatccgagagctggccatctgtact
gtgggtcgcctgagcagcatgaaccctgcctttgtcatgcctttcctgcgcaagatgtta
atccagattctaacagaactagagcacagtggtgttggtaggattaaagagcaaagtgcc
aggatgttgggtcacttggtttctaacgctccacgtctcattcgtccatatatggagcct
atccttaaggcactgatagtgaaactgaaagatcctgatccagatccaaacccaggggtg
attaacaatgttctagctaccattggggaacttgcacaggtcagtgggctggagatgagg
aagtgggtggatgaactcttcattataattatggacatgctacaggactcttccctgctg
gctaaaagacaagtggctctttggacactgggtcagcttgtggctagcactggttatgtg
gtggaaccctacaggaagtacccaactttattggaggtgcttctgaacttcctaaagact
gagcagaaccagggcacccgtagagaggctattcgtgtgttagggctgctgggtgctttg
gacccctacaaacacaaggtgaacattggcatgattgatcagtcacgagatgcttctgct
gtcagcctctcggagtccaaatctagccaggattcttcggactacagtaccagtgagatg
ctggtgaacatgggaaacctccctctggatgaattctatccagctgtctctatggtggca
ctgatgagaattttccgagaccagtccttgtcccagcaccacactatggtggttcaggcc
atcacctttattttcaaatcccttggactgaagtgtgtgcagttcctgccccaggtcatg
ccaacgttccttaatgtaataagggtttgtgatggtgccatccgagagttcctgttccag
cagctggggatgttggtgtcctttgtgagaagtcacattcggccctatatggatgaaatt
gtcaccctcatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttattgagcaaattgtggtggctctaggaggcgagttcaagctctatctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaatagtcagagtcgaattgtctctgtc
aagctattgaatgcaatccagctctttggagctaacctggatgactaccttcatttatta
ctacctcccattgtaaagctgtttgatgccccagatgccccagtggtggctcgcaaagct
gctcttgaaacggtggaccgcttgacagagtctctggattttactgattatgcttcacgg
attattcatcccattgtgcgaacactagatcagagcccagagctacgaacaactgcaatg
gacactctctcctctctggtattccagctgggaaagaagtaccagatctttatcccgatg
gtaaacaaagttctggtgcgacacagaattaaccatcaacgctacgatgttcttatctgc
agaattgtaaagggctatactcttgctgatgaggaggaggatcccctcatttatcaacat
cggatgttgagaagcaaccagggagaaaccttggccagtggtcccgtggaaacaggtcct
atgaagaaattacatgttagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtctccaaagatgactggttggaatggttaagaagactcagtttggagctgctgaaagat
tcctcctcaccatccttgcgctcatgctgggccctggctcaggcatataatcctatggct
cgagatctcttcaatgctgcttttgtttcatgctggtctgaactgaatgaagaccagcag
gatgagctgatccgaagcattgaattggccctgacttctcaggacattgcagaggtcact
cagacactgctgaacttggcagaattcatggagcacagcgacaagggtccactgcctttg
agagatgataatggcattgtcctcctgggggagagagcagcaaaatgtcgagcatatgcc
aaggctcttcactacaaagagctggaatttcagaagggtcccactccagccattctagag
tctcttatcagcattaacaataaactgcaacagccagaagcagctgctggggtgctggaa
tatgccatgaagcactttggggagctggaaattcaagctacctggtatgaaaagcttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaacaaagatgatcct
gagctgatgctgggacgaatgcgttgcttggaagcgcttggagaatggggccaactccac
cagcaatgctgtgaaaagtggacgcaggtcaatgatgaaactcaagctaagatggcaagg
atggctgctgctgctgcctggggtctaggtcagtgggacagcatggaagaatatacctgc
atgatcccaagggacacccacgatggtgccttctacagggctgtactggctcttcatcag
gaccttttctcactggctcagcagtgcattgacaaggccagagatctgctagatgccgag
ctgactgccatggcaggcgagagctatagtcgagcctatggggctatggtatcctgccag
atgctgtcggagctggaagaggttatccagtataaacttgtaccagaacgccgtgagatc
atccgccagatatggtgggaaagactgcagggctgtcaacggattgtggaagactggcaa
agaatattgatggttcggtctcttgttgtgaatcctcacgaggacatgagaacttggctt
aagtatgccagcttgtgtggcaagagtgggagactggctttggcccataagacacttgtc
ctgctcttgggagtagatccatcccgacagctggatcacccactgccaacagtacatccc
caagtgacttatgcatacatgaaacacatgtggaagagtgcccgtaagattgatgcattc
cagcatatgcagcactttgtacagacaatgcagcagcaggcacagcatgccattgccact
gaggaccagcagcacaagcaggagctccacaagcttatggcacggtgtttcctgaaactg
ggtgagtggcagctgaacctgcaaggcatcaacgagagtaccatccccaaagtcttacag
tactacagtgctgcaacagagcatgatcgtaactggtacaaggcctggcatgcctgggca
gtgatgaattttgaagcagtgcttcactacaagcatcagaaccaggccagagatgagaag
aagaaattgcgtcatgccagtggagccagtatcaccagtgccaacactgagggcagcaac
agtgagagtgatgcggagagcacagagaacagtcccatcccatctccagtgcagaaaaaa
gtcactgaggatttatccaagactctcttgatgtacactgtccccgctgtccaaggtttc
ttccggtccatatctctgtctcgaggaaacaacctacaagacactctcagagtacttact
ctatggtttgattatggtcactggcctgatgtgaatgaagctttggttgaaggggtcaag
gcaatccaaatagatacttggttgcaggttatccctcagcttattgcaagaattgacaca
cctcgaccattagtaggacgtctcattcatcagctcctcacagatattggacggtaccac
ccccaggctttgatctatcctttgactgtggcatctaaatccacaaccactgctcgccac
aatgctgcgaataaaatcttgaagaacatgtgtgagcacagtaacacgctggtgcagcag
gcaatgatggtaagtgaagagctaatccgtgtggcgatcctatggcatgagatgtggcat
gaagggttggaagaagcatctcgtctgtacttcggagaaagaaatgtgaagggaatgttt
gaggtgctggaaccacttcatgcaatgatggagcgtgggcctcagactttaaaagagaca
tccttcaatcaggcctatggcagagatctaatggaagctcaagagtggtgcaggaagtat
atgaaatcaggaaatgtcaaggacctaacccaggcttgggatctctactaccacgttttc
aggcgtatctcaaagcagctgcctcagctcacttctttggaactacagtacgtgtcacca
aaactcttaatgtgccgggacctggaattggcagtgccaggaacgtatgatcccaaccag
cccatcatccgcattcagtccattgcaccctcacttcaggtcatcacctccaagcagcgg
cccaggaaactaacattaatgggaagcaacgggcatgagtttgtgttccttctgaaaggt
catgaagaccttcgtcaagatgaaagagtgatgcagctttttgggttggtcaacactctg
ctagcaaacgacccaacttctcttcgtaaaaacctcagcatccagagatatgctgttatt
ccactgtccacaaattcaggcttaataggttgggtcccccactgtgacacactgcatgcc
ctcatccgcgactacagagagaagaaaaagatcctgctgaacattgaacatcgcatcatg
ctgaggatggctccagattatgaccacctgactttaatgcagaaggtagaagtatttgaa
catgctgtcaataacacagctggtgatgaccttgccaaactgctgtggttgaaaagtcca
agctcagaggtatggtttgacagaagaacaaactacactcgttcactagctgtgatgtca
atggttgggtacattctgggtcttggggacagacacccttccaatctgatgttagacaga
ctgagtggaaaaatcctgcatatcgactttggggactgttttgaggttgcgatgacaaga
gagaagttccctgagaagattccatttaggttaacaaggatgctgacaaacgctatggag
gtgacgggccttgatggcaattacagaatcacctgtcacacagtgatggaagtcctgcgc
gagcataaggacagtgtcatggctgtgctagaagcctttgtatatgatccattattgaac
tggaggctgatggacacaaatacaaagggcaataaacgttcacgaacaagaacagactcc
tactcagccagtcagtcagtagaaatgttagatggtatggaactgggggagacagcccat
aagaaaactgggaccacagtgcctgaatccatccattccttcataggagatggcctcgtg
aagccggaagctctgaataagaaagcaattcaaattatcaacagagttcgagataaactc
actggtcgagacttctctcatgatgaaactcttgatgtacccacacaagtagaattgctc
attaagcaagctacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system