KEGG   Gallus gallus (chicken): 419613Help
Entry
419613            CDS       T01006                                 

Gene name
RSPO1, R-spondin-1
Definition
(RefSeq) R-spondin 1
  KO
K19471  
R-spondin-1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
23
AA seq 260 aa AA seqDB search
MQLGLFVVVVFLSSMDLTGGSKVVKGKRQRRISTELSQGCARGCDLCSEFNGCLRCSPKL
FILLERNDIRQIGICLPSCPLGYFGLRNTDMNKCIKCKIENCESCFSRNFCTKCKEGLYL
HKGRCYVTCPEGYSAANGTMECSSPAQCEMSEWGPWGPCSKKRKLCGFKKGNEDRTRRIL
QAPSGDVSLCPATTEVRRCTVQKSQCPEGKRKKKDEQGKQDNTNGNRNRKDTKDAKSGTK
KRKSKQRGAVAPTTSASPAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggactgtttgtggtggtggtttttctaagctcgatggatctaacaggcggc
agcaaagtggtgaagggcaagaggcaaaggcgaattagcactgagctgagccagggctgt
gccaggggctgcgacctgtgctctgagttcaacgggtgcctgagatgttcccccaagctc
ttcatccttctggagaggaacgatatccggcaaattgggatctgcctcccatcctgtcca
ctgggatactttggccttcgcaatacagacatgaacaagtgcatcaaatgcaaaatcgag
aactgtgagtcctgcttcagccgaaacttttgcacaaaatgtaaggaaggtttgtatttg
cacaaagggagatgttacgtcacgtgccccgaaggctactctgctgccaacggcaccatg
gagtgcagcagtcctgcgcaatgtgaaatgagtgagtgggggccctgggggccctgctcc
aagaagaggaagctgtgtggcttcaagaaggggaacgaggaccgaacgcggcggatcctg
caggctccctctggggacgtgtccctgtgccccgccaccacggaggtgcgcagatgcact
gtgcagaagagccaatgccccgaagggaaaaggaagaaaaaggacgagcaaggaaagcaa
gataatacaaacgggaacagaaatcggaaagacaccaaagatgcaaagtctggcaccaag
aagaggaagagcaaacagaggggggctgtggcccccaccacatccgccagccctgcccaa
tag

DBGET integrated database retrieval system