KEGG   Gallus gallus (chicken): 419681Help
Entry
419681            CDS       T01006                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    419681 (PPT1)
  Lipid metabolism
   00062 Fatty acid elongation
    419681 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    419681 (PPT1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     419681 (PPT1)
Lipid biosynthesis proteins [BR:gga01004]
 Fatty acid synthase
  Component type
   419681 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
23
AA seq 302 aa AA seqDB search
MAALGLAVPALLWLGLGLGLGSGRAMAAVPLVIWHGMGDSCCNPLSMGYVRDLVQRRIPG
IYVLSLRIGSSLVQDVENSFFMNVNDQVREVCSQLAKDPHLKGGYNAMGFSQGGQFLRAV
AQRCPSPPMFTLISIGGQHQGVYGFPRCPGESSQICDWIRKMLDLGAYTQAVQEHLVQAQ
YWHDPLKEEDYRKKSIFLADINQERGINETYKKNLMALKKFVMVKFLNDTMVDPPISEWF
GFYKSGQAKDTIPLKETLLYKEDRLGLQQMDKAGKLVFLGVEGDHLHFTEEWFYTHILPF
LQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcgggctggcggtgccggcgctgctgtggctgggtctgggtctgggtctg
ggttcgggccgcgctatggccgccgttccactggtcatctggcacggcatgggagacagc
tgctgcaatccgctgagtatgggctacgtccgggacttggtgcagcgcagaatcccgggc
atctacgtgctgtccctgcgcatcggcagctccctggtgcaggatgtggagaacagcttc
ttcatgaatgttaatgaccaagtgagagaggtgtgcagccaactcgcaaaggacccccac
ctgaaaggaggctacaacgcaatgggcttctcccaaggaggccagttcctgagggccgtg
gcccagagatgcccttctcctcccatgttcactttgatctccattggggggcagcaccaa
ggagtgtatggctttccacgctgtcctggtgagagctcccaaatctgtgactggatccga
aagatgctggatctgggtgcctacacacaagctgttcaagagcacttggtacaagcacag
tattggcatgatcctttgaaggaggaggactacagaaaaaagagcatctttttggctgac
ataaatcaggagaggggcatcaatgagacatacaagaaaaacctgatggctttgaaaaag
ttcgtgatggtgaaatttctcaatgatactatggttgatcctccgatctctgagtggttt
gggttttacaaaagcggccaagccaaggacaccattcctttgaaggagaccttgctgtac
aaagaggatcgcctggggctgcagcagatggacaaagcaggaaagctggtgttcctgggg
gtggaaggggatcacctgcacttcacagaagagtggttttatacccatatcctcccattc
ctccagtga

DBGET integrated database retrieval system