KEGG   Gallus gallus (chicken): 419685Help
Entry
419685            CDS       T01006                                 

Gene name
LYPLA2, LYPLA2P1
Definition
(RefSeq) lysophospholipase II
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    419685 (LYPLA2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     419685 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_3 Hydrolase_4 Abhydrolase_6 Abhydrolase_1 FSH1 DLH Peptidase_S9 DUF2974 Cutinase Lipase_3 AXE1
Motif
Other DBs
NCBI-GeneID: 419685
NCBI-ProteinID: NP_001155854
CGNC: 2940
Ensembl: ENSGALG00000004002
UniProt: E1BRI5
Position
23
AA seq 232 aa AA seqDB search
MCGNNMSVPLLADAVTVSGAERETAAVIFLHGLGDTGHSWAEALSSIRLPYVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLTPDAPEDEAGIKKAAESIKAIIEHEMKNGIPPNRIILGG
FSQGGALSLYTALTCQHQLAGIVALSCWLPLHKAFPQAASNGVNKDIAILQCHGEMDPMI
PVRFGALTAEKLKSVVTPAKVQFKTYPGVMHNSCPQEMMAVKEFIEKLLPRI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtaacaacatgtctgtccccctcctcgctgatgccgtgactgtctcaggggca
gagcgggagactgccgcggtcatttttttacatggccttggagacacaggacacagctgg
gctgaagctctctcctccatccgcctcccctacgtgaagtacatttgccctcatgcaccc
cggatcccagtaaccctcaacatgaagatggtcatgccttcctggtttgacctgatgggc
ttgactccagatgcacctgaggatgaagccggaatcaagaaagctgcagagagcattaaa
gcaattatcgagcatgagatgaaaaatggaatcccacccaaccgtatcatcctgggaggc
ttctcacagggtggtgccttgtcactgtacacggctctcacctgccagcaccagctggcc
ggcatcgtggcgctcagctgctggctcccgctgcacaaggccttcccacaggcagcaagt
aacggtgtgaacaaggacattgccattctgcagtgtcatggggagatggatcctatgatc
cctgttcgctttggggccctcactgctgagaagctgaaatcagttgtgacccctgccaag
gtccagttcaaaacctaccctggtgtgatgcacaattcctgtcctcaggagatgatggcg
gtgaaggagttcattgagaagctgctgccccggatctaa

DBGET integrated database retrieval system