KEGG   Gallus gallus (chicken): 419751Help
Entry
419751            CDS       T01006                                 

Gene name
GRIK4
Definition
glutamate receptor, ionotropic, kainate 4
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
gga  Gallus gallus (chicken)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    419751 (GRIK4)
Ion channels [BR:gga04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   419751 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
24
AA seq 959 aa AA seqDB search
MPRVWAPLVLLLLWLMRTAASPHALRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVGVLGPSSSPASSSIISNICGEKEVPHFR
VAPEEFLKLQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDSRDPTPLLKEIRDDKTATIIVHANASMSHTILQKAAELGMASAY
YTYIFTNLEFSLQRLDSQLDDRVNILGFSIFNQSHAFFQEFVQSLNQSWQENCDHAPFTG
PALSSALLFDAVYAVVSAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQHTHSGFRQIGHWHVSEGLSMDNRIFSSNISDSLFNTTLIV
TTILENPYLMLKWNHQELEGNDRYEGFCVDMLKELAEILRFNYKIHLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCSQGRCNLLINQYSLGNSLWFP
VGGFMQQGSTIAPQALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQVGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWSLRHSEQSEVS
VCQEMVTELRNIILCKDSFHPRRRRGGMIRTRPAIPEERRARSTTTLSNGKLCSGGEPDP
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPAPGSPAQSEESLEWEKTTNSSEPE
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgtatgggcgcctctggtgctccttctgctgtggctgatgaggacggccgcc
agcccacacgccctgcgcattgctgccatcctggatgaccccatggagtgcagccggggg
gagaggctctccatcaccctggccaagaaccgcatcaaccgtgcgcccgagcgcctgggg
aaggccaaggtggaggtggacatcttcgagctgctgcgggacagcgagtatgagacggca
gaaaccatgtgccagatccttcccaaaggggtggtgggcgtcctggggccttcctccagc
ccggcctccagctcaattatcagcaatatctgcggggagaaagaggttcctcacttcaga
gtggcaccggaagagttcctgaagctgcagctccagcgcttcaccaccctcaacctccac
cccagcaacactgacatcagtgtggccgtggcaggaatcctcaacttctttaactgcacc
actgcctgcctcatctgtgccaaagctgaatgccttttaaacctagagaagttgcttcgg
cagttcctcatttccaaggacacgctctcagtccggatgctggatgacagccgggaccct
acgcctctcctcaaagagatcagagacgacaaaacggccaccatcattgtccatgccaac
gcctccatgtcccacaccatcctgcagaaggcagccgagctgggaatggcatctgcctat
tacacatatatcttcactaatctggagttttcactccagcgcctggacagccaattggat
gaccgagtcaacatcctgggattttccattttcaaccagtctcacgcctttttccaagag
tttgtccagagcctcaaccagtcctggcaggagaactgtgatcatgctccttttactggg
ccagcactctcctctgccctgctgttcgatgccgtgtacgccgtggtgagcgccgtgcag
gagctgaaccgcagccaggagatcggcgtgaagccgctgtcctgtggctctgcccagatc
tggcagcatggcaccagcctgatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacatcgaattcaacagcaaaggccagcgctccaactatgccctgaaaatcctgcag
cacacacacagcggcttccggcagatcggccactggcatgtttctgaaggactcagcatg
gacaacaggatattctcctccaacatatctgacagcctgttcaataccacactcatcgtc
accaccatcctggaaaacccttacttaatgctgaagtggaaccatcaggagctggaaggc
aacgaccgctacgagggcttctgcgtggacatgttgaaggagctggcagagatcctacgc
ttcaactataagatccacctggttggtgatggtgtctatggagtccctgaggcaaacggc
acgtggacagggatggtcggggagctgattgctcggaaagccgacctggcagtggcaggg
ctgaccatcaccgcggagcgggagaaggtgattgatttctctaagccattcatgactttg
ggaattagcattctctaccgagttcatatgggccgcaagcctggctatttctccttcctg
gaccccttttcccccggtgtgtggctcttcatgctgctcgcctacctggccgtcagctgc
gtcctcttcttggtggctcgcttgacgccctatgagtggtacagccctcacccctgctca
caaggcagatgcaaccttctcatcaaccagtactcactgggcaacagcctgtggtttcct
gtcggggggttcatgcaacaaggctccaccatcgccccccaggcgctctccacgcgctgc
gtcagtggagtctggtgggccttcaccttgatcatcatctcctcctacacggccaacctg
gcagccttcctcaccgtgcagcgcatggacgtccccattgagtctgtggatgacctggca
gaccagaccaccatcgagtatggcaccattcacggcggctccagcatgaccttcttccaa
aactcccgctaccagacgtaccagcggatgtggaactacatgtactccaagcagcccagt
gtctttgtgaagagcacggaggaagggatcgcgcgcgtgctgaactccaattacgccttc
ctgctggagtccaccatgaacgagtattatcgtcagcgcaattgcaacctcacgcaggtc
gggggccttctggacaccaagggctacgggattggcatgcccgtcggctctgtgttccgc
gatgagttcgacctggccatcctccagctgcaggagaacaaccggctggaaatcctgaag
cgaaagtggtgggaaggaggcaaatgtcccaaggaggaggaccaccgggccaaaggcctg
ggaatggagaacattggtggaatcttcgtggttctcatctgtggtttaatcgtagcgatt
tttatggcaatgctggaatttttgtggagccttcggcactctgagcagtcagaggtgtcg
gtgtgccaagagatggtgacagagctgcgcaacatcatcctctgcaaggacagtttccac
ccccgtcggaggcgaggggggatgatacggactcgccccgctatccccgaggagcgccga
gcccgcagcacgaccacgctcagcaatgggaagctgtgcagcgggggagagccagacccc
ctggcacaaagactggcacaagaagctgccctggtcgcccgaggctgcacacatatccgc
gtctgccccgagtgccgcaggttccaggggctccgggcacggccggctccgggctcaccc
gcacagagcgaggagagcttggagtgggagaagaccaccaacagcagcgagcccgagtaa

DBGET integrated database retrieval system