KEGG   Gallus gallus (chicken): 419762Help
Entry
419762            CDS       T01006                                 

Gene name
CADM1, IGSF4, Necl-2, RA175, SgIGSF, SynCAM1, TSLC1
Definition
(RefSeq) cell adhesion molecule 1
  KO
K06781  
cell adhesion molecule 1
Organism
gga  Gallus gallus (chicken)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    419762 (CADM1)
Cell adhesion molecules and their ligands [BR:gga04516]
 1. Immunoglobulin Superfamily
  Others
   PVRL3; poliovirus receptor-related 3 [KO:K06592]
    419762 (CADM1)
   CADM3, IGSF4B, NECL1, TSLL1; cell adhesion molecule 3 [KO:K06780 ]
    419762 (CADM1)
   CADM1, IGSF4, NECL2, TSLC1; cell adhesion molecule 1 [KO:K06781]
    419762 (CADM1)
   CADM2, IGSF4D, NECL3; cell adhesion molecule 2 [KO:K06782]
    419762 (CADM1)
   CRTAM; cytotoxic and regulatory T-cell molecule [KO:K16361]
    419762 (CADM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
24
AA seq 488 aa AA seqDB search
MAARAQHSGPAANGGGAPALLPLLLLLLSAAAIIPRGDGQNLITEDVTVVEGDVATISCR
VKNSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLVNFSNSELRVSLTNVSISDEGRYFCQ
LYTDPPQEIYTTITVLVPPRNLVIDIQKEIAVEGEEIELNCTAMASRPATTIRWFKGNKE
LTGKSEVEQWSDMYTVTSQLLLKVGREDDGVPVICLVDHPAVKDLQTQRYLEVMYKPQVR
VSQNYPVQGLTREGEPLELTCAAFGKPQPTDMRWLRVDDEMPQHVVVSGSNLLISNLNKT
DNGTYRCEASNAVGKSHADYMLFVYDPPTTIPPPTTTTTTTTTIPTTITDTTATTEPAVH
GFTQLPNSAEELDYGDLSGTGVLLNASTEALPTVQISNASIALHPDSRAGEEGAIRSVDH
AVVGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNS
EEKKEYFI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgcgcgcagcacagcggccccgcggcgaacggcggcggcgctccggccctc
ctcccgctgctcctcctgctcctctccgccgccgccatcatccccagaggtgatggccag
aacttgataacagaagatgtgacggtagtggagggggacgttgccaccatcagctgtcga
gtcaaaaacagcgacgactccgtgattcagctccttaatcccaacagacagaccatttat
ttcagagatttcagaccgctgaaggacagcaggtttcagctggtgaatttctccaacagt
gagctccgagtgtcgctgacgaacgtctctatttctgatgaaggacggtacttctgccag
ctctacacggatccgccgcaggaaatttacaccaccatcacagtgctggtcccaccacgc
aatttggtaattgatatccagaaagaaatcgctgttgagggagaagagattgagctgaac
tgcactgccatggccagcagaccagccaccaccatcagatggttcaaaggcaacaaggag
ctgactggcaagtcagaagtggagcagtggtctgatatgtacacagtgaccagccagctt
ttgctgaaagtgggacgggaggacgacggggtccctgtcatctgcttggtggatcacccc
gctgtcaaagacttgcagacacaacgctacctagaagtcatgtataagcctcaagtgcgg
gtttctcagaattacccagtgcaaggcctcacgagagaaggggagccgcttgaactgacg
tgcgcagcttttggaaaaccacagcctacggacatgaggtggttaagagtagatgatgag
atgcctcaacacgttgtagtgtctggttcaaaccttctcattagtaacctaaacaaaaca
gataatggtacataccgctgtgaggcttcaaacgcggtggggaaatcacatgcggattac
atgctgtttgtatacgatccccccacaactatccctcctcccacaacaaccaccaccact
accaccaccatccctaccaccatcacagacacaacggcgacgacagaaccggcagttcac
ggctttactcagttgccaaattccgcagaggagctggactatggggatctctcaggtact
ggtgtcctgctaaatgcttcaacggaggctctgccaactgtacaaataagtaatgcatct
attgccttgcatccagattctcgtgcaggtgaggaaggggcaataaggagcgtggaccat
gcagtcgtcggtggtgtcgtggccgtggttgtatttgccatgctttgcctgctcatcatt
ttagggcgatattttgcaagacataaaggtacatatttcactcacgaagccaaaggagcg
gacgatgcagccgacgcagacacagctatcatcaatgcagaaggaggacaaaacaactcc
gaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system