KEGG   Gallus gallus (chicken): 419825Help
Entry
419825            CDS       T01006                                 

Gene name
CNTN2, AXONIN-1, contactin-2
Definition
(RefSeq) contactin 2
  KO
K06760  
contactin 2
Organism
gga  Gallus gallus (chicken)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    419825 (CNTN2)
Cell adhesion molecules and their ligands [BR:gga04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     419825 (CNTN2)
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     419825 (CNTN2)
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     419825 (CNTN2)
   6/4 subfamily
    CNTN2; contactin 2 [KO:K06760]
     419825 (CNTN2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Others
  419825 (CNTN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
26
AA seq 1036 aa AA seqDB search
MGGTAAFICTSLAVIICVVWCQAQSGMRSYGPVFEEQPAHTLFPEGSAEEKVTLTCRARA
NPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCVATNARGTVVSREA
SLRFGFLQEFSAEERDPVKITEGWGVMFTCSPPPHYPALSYRWLLNEFPNFIPADGRRFV
SQTTGNLYIAKTEASDLGNYSCFATSHIDFITKSVFSKFSQLSLAAEDARQYAPSIKAKF
PADTYALTGQMVTLECFAFGNPVPQIKWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYE
CEAENIKGRDTYQGRIIIHAQPDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQ
PLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTVYASAELTVQALAPDFRLNPVK
RLIPAARSGKVIIPCQPRAAPKATVLWTKGTELLTNSSRVTITADGTLILQNISKSDEGK
YTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGENLTLQCHASHDPTMDLTFTWS
LDDFPIDLDKSEGHYRRASVKEAVGDLAIVNAQLKHSGRYTCTAQTVVDSTSESATLTVR
GPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIARYSIEARTLLSNKWKQMRTNPVNIEG
NAETAQVVNLIPWMDYEFRVLASNILGVGEPSLPSSKIRTKEAAPTVAPSGLGGGGGAPN
ELIINWTPTLRDYQNGDGFGYILSFRKKGTQGWLTARVPHAESLHYVYRNESIGPYTPFE
VKIKAYNRKGEGPESLTAIVYSAEEEPKVAPFRVTAKAVLSSEMDVSWEPVEQGDMTGVL
LGYEIRYWKDGDKEEAADRVRTAGLVTSAHVTGLNPNTKYHVSVRAYNRAGAGPPSPSTN
ITTTKPPPRRPPGNISWTLTGSTVTIKWDPVVAQADESAVTGYKMLYRQDSHSAPTLYLA
SKSRIDIPVPEDFTHAFVQIRVTGPGGDGTPAEVHIVRNSGTSMMVEDSVTRPVPHAAII
TTNSLAMVALIRYLEL
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcactgctgcattcatctgcacctccctggccgtcatcatctgcgtggtctgg
tgccaagcacagagtggcatgaggagctacgggccggtgtttgaggagcagccagcacac
accctgttccctgaaggctcagcagaagagaaagtgacgctgacgtgtcgagccagagcc
aacccccctgcaacatacagatggaagatgaacggcacagagctgaagatggggccggat
tcacggtacaggttggttgctggggacctggtgataagcaacccagtgaaagcaaaggat
gcaggctcctaccagtgtgtggcaaccaacgcccgtggcacagtggtcagcagggaagca
tccctccgctttggctttttgcaggaattctctgcagaagagcgagaccccgtgaagatc
accgaaggttggggagtgatgttcacctgcagcccccctccccattacccagccttgtcc
taccggtggcttctgaatgagtttcccaacttcatcccagccgacggaaggcgtttcgtc
tctcagaccacaggaaacctctacattgccaagacagaggcttccgacctcggcaactac
tcgtgctttgccaccagccacatcgacttcatcaccaagagcgttttcagcaagttctcc
cagctcagcctggctgccgaggacgccaggcagtatgcacccagcataaaagccaagttc
cctgcagacacctacgctctgaccgggcagatggtgactctggagtgtttcgcctttggg
aaccccgttcctcaaataaagtggaggaagctggatggctcgcagacctccaagtggctc
tccagtgagcccctcctgcacatccaaaatgttgactttgaagatgaaggcacttatgag
tgcgaggctgaaaacatcaaagggagggacacctaccagggccgcatcatcattcacgct
cagccggactggctggatgtgatcacggacacggaagctgacattgggtccgacctgcgc
tggagctgcgtggcatccggcaaaccccggccagcagtgcggtggctgcgggatgggcaa
cctctggcctcccagaaccgcatcgaagtgagcggtggagagctgagattttccaagcta
gtcctggaggactctggcatgtatcagtgtgtggctgagaacaagcatggcacagtatat
gcaagtgctgaattaacagtgcaagccttagcaccagattttagactaaacccagttaaa
cgactgatacctgcagcccggagtgggaaggtcatcatcccatgccaaccgagagcagca
ccaaaagccactgtgctctggaccaaagggaccgaactgctcaccaacagcagcagggtg
actattactgctgatggcaccttgatcctccagaacataagcaaatctgatgagggaaag
tatacctgctttgctgagaatttcatgggcaaagccaacagcacggggatcctctctgtt
cgagatgccaccaaaatcacactggcaccatccagcgctgatatcaatgtgggtgaaaac
ctcactctgcagtgccacgcatcccacgacccaaccatggacctaaccttcacctggtca
ctggatgatttccccattgacttggacaagtcggaggggcattaccggcgagccagcgtg
aaggaagctgttggggaccttgccatcgtcaatgcccagctgaagcactcggggcggtac
acatgcacagcccaaacggttgtggacagcacttcggagtcggccacgctgactgtcaga
ggaccccccgggcccccagggggtgtggtggtgagagacattggtgacaccactgtccag
ctgagctggagccgtggctttgacaaccacagccccatcgccaggtacagcattgaggcc
aggacgctgctctccaacaaatggaagcagatgcgcaccaatcctgtaaacatcgaaggc
aacgccgagacagcccaggtggtgaacctcatcccttggatggattacgagtttcgggtc
ttagcaagtaacatccttggagttggggagccaagcttaccctccagcaaaatccgtacc
aaagaagcagcacccacggtggcaccatctgggctcggcggcggcggtggggctcccaat
gagctcatcatcaactggacgccaacactgcgggactaccagaatggagacggcttcggc
tacatcctgtcgtttcgtaagaagggcactcagggatggctcactgcccgcgtgcctcat
gcagaatccctgcattacgtgtaccgcaacgagagcattgggccctacacccccttcgag
gtgaagatcaaagcatacaacaggaaaggagagggaccggagagcctcactgccatcgtg
tactctgcagaagaagaaccaaaagtggctccattcagagttacggccaaagccgttcta
tcctcagaaatggatgtgtcctgggagccagtggagcagggagacatgactggtgtgctg
ctgggctatgagatccggtactggaaagacggcgataaagaggaggcagctgacagagtg
agaacagcagggttggtcacatcggctcacgtcacaggcctaaatcccaacacgaagtac
cacgtctcagtgagagcctacaaccgtgctggagctgggccccccagcccctctaccaac
atcacgaccacaaagccaccaccaaggaggccaccaggcaacatctcctggactctgact
gggtctaccgtcaccatcaagtgggacccagtggtggcacaggcagatgagtctgcagtt
acagggtacaagatgctttacaggcaggattctcactctgctcccacgctgtacctggcg
agcaagagccggattgacatcccagtgcctgaggacttcactcatgccttcgtacagatc
cgggtgacggggcctgggggggacgggaccccagcagaagtccacatcgtccgaaacagt
gggaccagtatgatggtggaagactccgtgacgaggccggtgccacacgctgccatcatc
accaccaactccctggccatggtggccctgatccgctacctggagctctga

DBGET integrated database retrieval system