KEGG   Gallus gallus (chicken): 419846Help
Entry
419846            CDS       T01006                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
26
AA seq 551 aa AA seqDB search
MRIDQLRYQESANEEHSPSGLPSLGRSNVCSNKLAMKDHPLSGSQVKVEQLFEDSGNRRS
STLQSTGITCSERSLPSLTKDKSIESLSTCKGGSSSSKAHKAISQAPEQAVKQYKHQLSA
YEQQEIFNFSEIYFVGPAAKKRQGVIGGPNNGGYDDDQGSYIHVPHDHLAYRYEVLKIIG
KGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLE
SFTFRNHICMTFELLSMNLYELIKRNKFQGFSVQLVRKFAHSILQCLDALYRNKIIHCDL
KPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFG
CILVELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLDQSKRAKNFINSKGHPRYCTVTT
HADGRVTLNGSRSRRGKVRGAPGNKDWVTALKGCDDPLFIEFLKECLSWDPAVRMTPSQA
LRHPWICKRTPKPPSTDKTSSKRISSYTSSFTGIGSKLPPVVGVANKLRANLTSDTNGSI
PLCTVLPKLVS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagatcagcttaggtaccaagagtctgcaaatgaagagcacagcccctcagga
ctgccttccctcggaagatctaatgtttgtagcaacaaacttgcgatgaaggatcaccct
ctgagtgggagccaggtcaaagtggaacagttgtttgaggactctgggaacagaaggagt
agtacccttcagtctacaggaattacttgttcagaaagatctcttccttccctgacgaaa
gataaaagcatagagagcttaagcacttgtaaaggtggcagcagttcctcaaaagcacac
aaagccatttcccaggctccagaacaagctgtcaaacagtacaagcatcagttatctgcg
tatgagcagcaagagatatttaacttctctgagatttactttgtgggtccagctgcaaag
aagaggcaaggagtgattggtggtcccaacaacggaggttatgatgatgaccaaggcagc
tacattcacgtgccccacgaccatctcgcttaccgctatgaagtgctcaaaatcattggc
aagggcagttttggacaagttgctaaagtctatgatcacaaactccaccagcacttagcc
ttaaagatggttcgcaatgaaaagagattccatcgccaagcagcggaagaaatccggatc
ctggagcacctgaagaagcaggataaaactggcagtatgaacgttattcacatgctggaa
agcttcacctttcggaaccacatctgtatgacctttgaactcttgagtatgaacttgtat
gagctgattaagagaaataagttccagggcttcagcgtccagctggtgcgcaagtttgct
cactctatactgcagtgcttggatgctctctatagaaacaaaatcatacactgtgacttg
aagccggaaaatatcctcctaaaacagcaagggaggagtggaatcaaggttatagatttt
gggtccagctgttttgagcaccaaagagtctacacgtacattcagtctcgattttatcga
gcaccagaggtaattttaggaagtcgttatgggatgcccatagatatgtggagttttggc
tgtattctggtggagctattgactggataccctctttttcctggagaggatgagggagac
caattggcttgtatgatggaacttcttggaatgccccctcagaagcttttggatcaatcc
aagcgagccaagaactttatcaactccaagggtcatcctcgctactgcactgtgactact
catgcagatggaagagtgaccctcaacgggagccgatcacgcagggggaaagtgcgaggt
gctccagggaacaaggactgggtgacagcactgaaaggctgcgacgaccccttgttcata
gagttcttaaaggaatgtctcagctgggatcctgctgtgcgcatgacgccaagtcaagct
ttaaggcacccgtggatttgtaaacgaacacccaaaccacccagcactgataaaacctcc
agtaaaaggatttccagctacacgagttctttcacgggaattggttccaagttgcctcct
gtggttggggtagcaaacaagctgagggccaacttaacgtccgacaccaatggcagtata
cctttatgtactgtgctgccaaagctggtcagctag

DBGET integrated database retrieval system