KEGG   Gallus gallus (chicken): 419960Help
Entry
419960            CDS       T01006                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
gga  Gallus gallus (chicken)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    419960 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    419960 (CDC27)
   04114 Oocyte meiosis
    419960 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    419960 (CDC27)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     419960 (CDC27)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     419960 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
27
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHNISHRQPETVLMETPQDTIELNRINLESSNAKYSSLNTDSSMSYIDSAV
ISPDAVPLGSGTAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNSTSVIDVPSTGAPSKKAVTRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTST
TPQVLSPTIAAPPNSLPRRSSRLFTSDSSTTKENSKKLKMKFPPKIANRKTKSKTNKGGI
TQPNINDSLEITKLDSSIISEGKISTVAPQIQAFTLQKAAAGLMSLLRDMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcacttaaccactatgct
taccgcgatgcagtgttcctcgcagaaaggttgtatgcagaagtacattcagaagaagca
ctgtttttgctggcaacgtgttactaccgctcaggaaaggcatataaagcatacaggctc
ctaaagggacacagctgtactactccacagtgtaaatacctgcttgctaaatgttgtgtt
gacctcagcaagcttgcagaaggagagcagatcttatctggtggagtgttgaataaacag
aaaagccatgatgacattgtcacggagttcggtgactctgcgtgctttacactctcctta
ctgggacatgtctactgcaagacagaccggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgaatcgctgtgtgaaataggtgaa
aaaccagaccccgaccaaacgtttaaattaacatctttacagaacttcagcagctgtctg
cctaacacttgcacaacgttggtgtctaatcacaacatatcccacagacagcctgagact
gtcctgatggaaacgccgcaagacacaattgagttgaacaggatcaacctagaatcctcc
aatgcaaaatactcctccttgaacacagattcctctatgtcttacatcgactcggctgta
atttcaccagatgctgtccctcttgggtcaggaactgctatcttgtcgaaacaggctcaa
aataaaccaaaaactgggcgaagtttactgggaggacctgctgctttgagccccctaact
ccaagctttggaattttgccactagaaaccccaagccctggagatggatcctatttgcag
aactacacaaactctacttctgtaattgatgtgccatccactggagctccttcaaagaag
gcggtcaccaggatcagccaggctggaacaaaatcagtcttctcccagagtggaaatagc
cgggaggtcactccaatcctcgttgcacaaacacagagctctggtccacagacaagtaca
acacctcaggtattgagcccaacaattgctgctccaccaaactcactgcctcgaagaagc
tctcgcctttttactagtgatagctccacaacaaaggaaaatagcaaaaaattaaaaatg
aagtttccacctaagattgcaaacaggaaaacaaaaagcaaaacaaataagggggggata
actcagccaaacataaacgatagcttggaaattaccaaactggactcttccatcatttca
gaagggaaaatatctactgttgcaccgcagatccaggcttttacgctacagaaggcagca
gcaggtttgatgagccttcttcgtgacatgggaaaaggttatttagccttgtgctcatac
aactgcaaagaagcgataaatattctaagccatttgccatctcaccactacaacactggc
tgggtgctgtgccaaattgggagagcttactttgaactcgcagaatacatgcaggctgaa
aggatattttcagaagtgaggaggattgaaaactacagagtagaaggcatggagatctat
tcaactacgctgtggcatctgcagaaagacgttgctctttcagttctttcaaaggattta
acagacatggataaaaactcaccagaggcatggtgtgctgcagggaactgcttcagcttg
caacgagagcacgacattgcaatcaagttcttccagagagccattcaagttgatccaaac
tatgcttacgcctacacccttttggggcatgaatttgtgttaacagaagagctagacaaa
gcactagcttgttttaggaatgcaatcagagtcaaccctagacactataatgcatggtat
ggattgggaatgatttattacaaacaggaaaaattcagtttagcagaaatgcatttccag
aaagcacttgatatcaatcctcagagctcagtcttactgtgtcacattggagtagtccaa
cacgcactgaaaaaatctgaaaaggctttggatactctaaacaaagctattaacattgac
cccaagaatccactatgcaaattccatagagcttctgtattgtttgcaaatgagaaatac
aagtctgctttacaagaacttgaagaactgaaacagattgttcccaaagagtctcttgtt
tacttcttaataggaaaggtttataaaaagctggggcaaactcatttggccctaatgaat
ttctcatgggcgatggacttagatcccaaaggagccaacaaccaaattaaagaggctatc
gataaacgttaccttccagatgatgaggaaccaataactcaagaagagcaaatcagtgaa
tgttatccctacgaatcagttggcacagacgaatcccaagagagcagcatgacggatgca
gatgacacacagctccatgcagttgaaagtgatgaattttaa

DBGET integrated database retrieval system