KEGG   Gallus gallus (chicken): 419960Help
Entry
419960            CDS       T01006                                 

Gene name
CDC27
Definition
cell division cycle 27 homolog (S. cerevisiae)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
gga  Gallus gallus (chicken)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:gga04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:gga04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:gga04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:gga04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
27
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHNISHRQPETVLMETPQDTIELNRINLESSNAKYSSLNTDSSMSYIDSAV
ISPDAVPLGSGTAILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNSTSVIDVPSTGAPSKKAVTRISQAGTKSVFSQSGNSREVTPILVAQTQSSGPQTST
TPQVLSPTIAAPPNSLPRRSSRLFTSDSSTTKENSKKLKMKFPPKIANRKTKSKTNKGGI
TQPNINDSLEITKLDSSIISEGKISTVAPQIQAFTLQKAAAGLMSLLRDMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQISECYPYESVGTDESQESSMTDADDTQLHAVESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcacttaaccactatgct
taccgcgatgcagtgttcctcgcagaaaggttgtatgcagaagtacattcagaagaagca
ctgtttttgctggcaacgtgttactaccgctcaggaaaggcatataaagcatacaggctc
ctaaagggacacagctgtactactccacagtgtaaatacctgcttgctaaatgttgtgtt
gacctcagcaagcttgcagaaggagagcagatcttatctggtggagtgttgaataaacag
aaaagccatgatgacattgtcacggagttcggtgactctgcgtgctttacactctcctta
ctgggacatgtctactgcaagacagaccggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccttttgaatcgctgtgtgaaataggtgaa
aaaccagaccccgaccaaacgtttaaattaacatctttacagaacttcagcagctgtctg
cctaacacttgcacaacgttggtgtctaatcacaacatatcccacagacagcctgagact
gtcctgatggaaacgccgcaagacacaattgagttgaacaggatcaacctagaatcctcc
aatgcaaaatactcctccttgaacacagattcctctatgtcttacatcgactcggctgta
atttcaccagatgctgtccctcttgggtcaggaactgctatcttgtcgaaacaggctcaa
aataaaccaaaaactgggcgaagtttactgggaggacctgctgctttgagccccctaact
ccaagctttggaattttgccactagaaaccccaagccctggagatggatcctatttgcag
aactacacaaactctacttctgtaattgatgtgccatccactggagctccttcaaagaag
gcggtcaccaggatcagccaggctggaacaaaatcagtcttctcccagagtggaaatagc
cgggaggtcactccaatcctcgttgcacaaacacagagctctggtccacagacaagtaca
acacctcaggtattgagcccaacaattgctgctccaccaaactcactgcctcgaagaagc
tctcgcctttttactagtgatagctccacaacaaaggaaaatagcaaaaaattaaaaatg
aagtttccacctaagattgcaaacaggaaaacaaaaagcaaaacaaataagggggggata
actcagccaaacataaacgatagcttggaaattaccaaactggactcttccatcatttca
gaagggaaaatatctactgttgcaccgcagatccaggcttttacgctacagaaggcagca
gcaggtttgatgagccttcttcgtgacatgggaaaaggttatttagccttgtgctcatac
aactgcaaagaagcgataaatattctaagccatttgccatctcaccactacaacactggc
tgggtgctgtgccaaattgggagagcttactttgaactcgcagaatacatgcaggctgaa
aggatattttcagaagtgaggaggattgaaaactacagagtagaaggcatggagatctat
tcaactacgctgtggcatctgcagaaagacgttgctctttcagttctttcaaaggattta
acagacatggataaaaactcaccagaggcatggtgtgctgcagggaactgcttcagcttg
caacgagagcacgacattgcaatcaagttcttccagagagccattcaagttgatccaaac
tatgcttacgcctacacccttttggggcatgaatttgtgttaacagaagagctagacaaa
gcactagcttgttttaggaatgcaatcagagtcaaccctagacactataatgcatggtat
ggattgggaatgatttattacaaacaggaaaaattcagtttagcagaaatgcatttccag
aaagcacttgatatcaatcctcagagctcagtcttactgtgtcacattggagtagtccaa
cacgcactgaaaaaatctgaaaaggctttggatactctaaacaaagctattaacattgac
cccaagaatccactatgcaaattccatagagcttctgtattgtttgcaaatgagaaatac
aagtctgctttacaagaacttgaagaactgaaacagattgttcccaaagagtctcttgtt
tacttcttaataggaaaggtttataaaaagctggggcaaactcatttggccctaatgaat
ttctcatgggcgatggacttagatcccaaaggagccaacaaccaaattaaagaggctatc
gataaacgttaccttccagatgatgaggaaccaataactcaagaagagcaaatcagtgaa
tgttatccctacgaatcagttggcacagacgaatcccaagagagcagcatgacggatgca
gatgacacacagctccatgcagttgaaagtgatgaattttaa

DBGET integrated database retrieval system