KEGG   Gallus gallus (chicken): 420023Help
Entry
420023            CDS       T01006                                 

Gene name
EZH1
Definition
enhancer of zeste homolog 1 (Drosophila)
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     420023 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
27
AA seq 794 aa AA seqDB search
MTAAWAGISEGRTPLLGAVKMEIATPPTSKCIIYWKRKVKSEYMRLRQLKRFQANMGAKA
LFVANFAKVHEKTRILNEDWKKLRVQPVQLMKPVSGHPFLKQCTVESIFPGFPSQTLYMR
TLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHG
EEEMISGSVLISDAVFLELVNALNQYSDEEEEGHNDSEAKQEDGKEELPVTRKRKRIAVE
GNKKCSKKRFPNDMIFTAISSMFPEYGFPDDMKERYRELTEVSDPNVLPPQCTPNIDGPC
AKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNRETKIEPDPCGADCFLWL
EGAKEFAALHNPRSKCSGRRRRRHHVVSASCSNAPASAVAETREGDSDRDTGNEWASSSS
EANSRCQTPTKQKLSPTSSQLFAVEAQQEPVEWTGAEESLFRVFHGTYFNNFCSIARLLG
TKTCKQVFQFAVKESLITKLPTNELMNPSQKKKRKHRLWAAHCRKIQLKKDNSPTQVYNY
QPCDHPEHPCDSSCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVREC
DPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISE
YCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKGE
LSSHRPFKVEEESLVLLSSENTGRSLGFQVTLSPSELKNIRDIGKLSSWLQITFLLLGAL
LSSAVALTLQGDRC
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcctgggccgggatctcagagggaaggacccccctgctgggggctgtaaaa
atggaaatcgccacccctccaacatcaaagtgtattatctactggaaaagaaaagtcaag
tctgaatatatgcgtcttcggcagctcaagagatttcaggcaaacatgggagcaaaggct
ctgtttgtggccaactttgcaaaggttcatgaaaagactcgaattcttaatgaagactgg
aagaagcttcgagttcaaccagtgcagctgatgaagccagtcagcgggcaccccttccta
aaacagtgtacagttgagagcatttttccaggatttccaagccagacgctgtacatgagg
acactgaacacggtggcactggtgcctatcatgtactcctggtccccccttcagcagaac
ttcatggtggaggatgaaactgttctgtgcaacatcccttacatgggagatgaggtgaag
gaagaggatgaaaccttcattgaagagcttattaataactatgatgggaaagttcatgga
gaggaagaaatgatttcaggttcagtcctcatcagtgatgctgtcttcctggagctagtg
aatgccctgaatcagtactcagatgaggaagaggaaggacacaatgattctgaagccaaa
caggaggatgggaaagaggaactgccagtcacaagaaaaagaaaacgaattgcagtggaa
ggtaacaagaagtgttccaagaaacggtttccgaatgacatgatattcactgccatttct
tctatgtttcctgaatatggcttcccagatgacatgaaagagaggtaccgagagctcact
gaggtgtcggatcccaatgtgctgcccccgcagtgcactcccaacatcgacgggccatgc
gcaaagtctgtgcagcgggagcagtccctgcactccttccacacgctcttctgccggcgc
tgcttcaaatacgactgttttctgcatccttttcatgctactcctaatgtgtacaaacga
aagaacagagagaccaagattgagccagatccttgcggagcagactgtttcctctggctg
gaaggagccaaggagtttgctgcacttcacaatcccaggtccaagtgctcaggcaggcgc
cgccggaggcaccatgtggtcagtgcttcctgctcaaatgccccagcttctgcggttgct
gagacaagggagggagacagcgacagagacacgggcaatgagtgggcttctagttcctcg
gaggcaaactcccgctgtcagacccctactaagcagaagctgagcccgacctcatcccag
ctgtttgcagtggaggcacagcaggagccagtcgagtggacaggagctgaggagtccctc
ttccgtgtcttccatgggacctacttcaacaacttctgctccattgccagactgctggga
acaaagacatgcaagcaggtctttcagtttgcagtgaaagagtcacttataacaaaactg
ccaacaaatgaattgatgaatccatcccagaagaagaaaaggaagcacaggctgtgggct
gcccattgcaggaagattcagctgaagaaagacaattcacctacccaggtgtacaactac
cagccctgtgaccatcctgaacatccctgtgacagctcctgcccttgcattatgacccaa
aatttctgtgagaagttctgccagtgcaaccctgactgtcagaatcgcttcccaggctgc
cgctgtaagacccagtgcaacaccaagcagtgcccatgctacttggccgtgcgggagtgc
gatccagacctctgcctgacctgcggggcatcagagcactgggactgcaaggttgtctcc
tgcaagaactgcagcatccagcgcggtctcaaaaagcatttgttgctggcaccatcagat
gttgctggctgggggactttcatcaaagaatctgtgcagaagaatgaattcatctctgaa
tactgtggtgagcttatttcacaggatgaggctgaccggcgaggaaaggtctatgacaag
tacatgtcaagtttcctcttcaacctcaacaatgattttgttgttgatgccactcgcaaa
ggaaataaaatccgctttgccaaccactccgtgaaccccaattgctatgccaaaggtgag
ctatcctcacacaggccattcaaggtggaggaagaatctctggtcctactcagctctgag
aacacaggacgttcactggggttccaagtcacactgagtccatcggagctgaagaacatc
agagacataggcaaactctcctcgtggctgcaaatcacattcctactgttgggggctctg
ctcagctctgctgtggctctgaccttgcagggagatcgctgctag

DBGET integrated database retrieval system