KEGG   Gallus gallus (chicken): 420120Help
Entry
420120            CDS       T01006                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
gga  Gallus gallus (chicken)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:gga04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:gga04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
28
AA seq 761 aa AA seqDB search
MISALAFVFLLCLSCPFSSCQQRRAGIEVGPEMLEEMRETNRVLMEVRDLLKQQIKEITF
LKNTVMECDACGMRPEVTGPVITVTQFNRCVPNPCFPGVACTETSTGFRCGPCPPGYSGN
GSQCTDINECSANPCFPKVQCINTAPGFRCDPCPPGFTGQMVEGVGLAYARANKQVCTDI
NECETGAARNCVPNSICINTRGSYKCGACKPGFVGDQITGCKSQTGRLCPNGQVSPCHEK
AQCIVERDGSISCACLVGWAGNGYICGKDTDIDGVPDEKLRCSDKKCRKDNCMTVPNSGQ
EDADRDGIGDACDDDADGDGILNAEDNCVYTRNADQRNADKDNFGDACDNCRLVKNDDQR
DIDGDGKGDECDDDIDGDGISNARDNCRRVPNPDQKDSDGDGVGDICDSCPTVSNPDQKD
TDHDLVGDVCDTNQDSDGDGHQDTRDNCPSVPNSSQVDTDNDGLGDECDDDDDNDGIPDE
KPPGPDNCRLVPNPGQEDSDGDGVGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDY
AGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLWH
TGDTTDQVKLLWKDPRNSGWKDKTSYRWFLQHRPQVGYIRARFYEGPEVVADTGVVLDTT
MRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYETFKVQQD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagctctagcctttgtttttctcctctgcctctcctgtcctttttcatcatgt
cagcagagaagagcaggaattgaagttgggcctgaaatgctggaagagatgagagaaact
aaccgtgtgttaatggaagttcgagacctgttgaaacagcagattaaggagataacattc
ctgaagaacacagtcatggagtgtgatgcctgtggcatgcgccctgaagtgacaggccct
gtcatcactgtgacgcagttcaacagatgtgtcccaaacccctgctttcctggagtggcc
tgcactgagaccagcactggcttccggtgtggaccctgtcctccaggttattcagggaat
gggtcccagtgcacagatatcaatgagtgcagtgcaaacccctgcttcccaaaggtccag
tgcattaacactgctcctggcttccgctgtgatccctgccctccaggcttcactgggcaa
atggtcgaaggggttggactagcttatgccagggccaacaaacaggtttgcactgacatc
aatgaatgtgagacaggtgctgccagaaattgtgtcccaaattctatctgtatcaataca
cggggatcatacaagtgcggagcttgtaaacctggctttgttggggatcaaatcactggc
tgcaagagccagacggggagactctgccctaacggtcaagtcagcccatgccacgagaaa
gcacagtgcatcgtggagcgggatgggtccatctcctgcgcgtgccttgtggggtgggca
gggaatggctacatctgtgggaaggatacagacattgacggagtccctgatgaaaagctg
cgctgctctgacaagaagtgccgcaaggataactgcatgactgtccccaactctggccag
gaggatgcagacagggatggaattggagatgcctgtgatgatgatgctgatggagatggg
atattaaatgctgaggacaactgtgtgtacacacgcaatgcagaccagcgcaatgcagac
aaggataactttggtgatgcctgtgacaactgtcgtctagtgaagaacgatgaccagcgg
gacattgatggtgatgggaaaggagatgagtgtgatgatgacatagatggagatgggatc
agtaatgcaagggacaactgtagaagagttcctaaccctgatcaaaaagatagtgatggt
gatggagtaggagatatatgcgacagctgcccaacagtcagtaacccagaccagaaagat
actgatcatgatctagtgggagatgtctgtgacaccaaccaggacagtgatggcgatggc
caccaagatacaagagataactgcccatcagtgcctaacagctcccaggtggacacagac
aacgatggactaggagatgaatgtgatgatgatgatgacaatgatgggattccagatgag
aaacctccaggccctgacaactgtcggcttgtccctaaccctggccaagaagattcagat
ggtgacggtgtaggaaatctttgcgaagatgactttgacagagacatggtgattgacagg
attgatgtgtgcccagagaacgcagaagtgacgctaacagacttcagggctttccagaca
gttgtgttggaccctgagggtgatgcacagattgaccccaactggattgtccttaaccag
ggcatggaaattgtccaaaccatgaacagtgatcctggcttggctgtaggttatacagca
ttcaatggagtggactttgagggcacattccatgtcaatactgccacagatgatgattat
gctggcttcatatttggctaccaggacagttccagcttttatgtggtcatgtggaagcag
atggaacagacatactggcaggcaaaccccttccgagcagtcgcagaacctggtattcaa
ctgaaggcagtgaagtccaaaacaggcccaggtgagtatctccgcaattctctctggcac
actggggacaccacagaccaggtcaaactgctgtggaaggaccctcgcaactctggctgg
aaggacaagacctcgtaccgctggttcctgcagcatcggcctcaagttggatacatcaga
gctcgcttctatgaaggccctgaggttgtagcagacactggagttgtccttgatacaact
atgcgaggagggcgcctgggagtcttctgcttctcccaggagaacattatttggtcaaac
ctgcgttaccgctgcaatgatactattccagaagactatgaaacatttaaagttcagcaa
gactaa

DBGET integrated database retrieval system