KEGG   Gallus gallus (chicken): 420120Help
Entry
420120            CDS       T01006                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
gga  Gallus gallus (chicken)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    420120 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    420120 (COMP)
  Cell communication
   04510 Focal adhesion
    420120 (COMP)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   420120 (COMP)
  Exosomal proteins of colorectal cancer cells
   420120 (COMP)
  Exosomal proteins of bladder cancer cells
   420120 (COMP)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  420120 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
28
AA seq 761 aa AA seqDB search
MISALAFVFLLCLSCPFSSCQQRRAGIEVGPEMLEEMRETNRVLMEVRDLLKQQIKEITF
LKNTVMECDACGMRPEVTGPVITVTQFNRCVPNPCFPGVACTETSTGFRCGPCPPGYSGN
GSQCTDINECSANPCFPKVQCINTAPGFRCDPCPPGFTGQMVEGVGLAYARANKQVCTDI
NECETGAARNCVPNSICINTRGSYKCGACKPGFVGDQITGCKSQTGRLCPNGQVSPCHEK
AQCIVERDGSISCACLVGWAGNGYICGKDTDIDGVPDEKLRCSDKKCRKDNCMTVPNSGQ
EDADRDGIGDACDDDADGDGILNAEDNCVYTRNADQRNADKDNFGDACDNCRLVKNDDQR
DIDGDGKGDECDDDIDGDGISNARDNCRRVPNPDQKDSDGDGVGDICDSCPTVSNPDQKD
TDHDLVGDVCDTNQDSDGDGHQDTRDNCPSVPNSSQVDTDNDGLGDECDDDDDNDGIPDE
KPPGPDNCRLVPNPGQEDSDGDGVGNLCEDDFDRDMVIDRIDVCPENAEVTLTDFRAFQT
VVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDY
AGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLWH
TGDTTDQVKLLWKDPRNSGWKDKTSYRWFLQHRPQVGYIRARFYEGPEVVADTGVVLDTT
MRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYETFKVQQD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagctctagcctttgtttttctcctctgcctctcctgtcctttttcatcatgt
cagcagagaagagcaggaattgaagttgggcctgaaatgctggaagagatgagagaaact
aaccgtgtgttaatggaagttcgagacctgttgaaacagcagattaaggagataacattc
ctgaagaacacagtcatggagtgtgatgcctgtggcatgcgccctgaagtgacaggccct
gtcatcactgtgacgcagttcaacagatgtgtcccaaacccctgctttcctggagtggcc
tgcactgagaccagcactggcttccggtgtggaccctgtcctccaggttattcagggaat
gggtcccagtgcacagatatcaatgagtgcagtgcaaacccctgcttcccaaaggtccag
tgcattaacactgctcctggcttccgctgtgatccctgccctccaggcttcactgggcaa
atggtcgaaggggttggactagcttatgccagggccaacaaacaggtttgcactgacatc
aatgaatgtgagacaggtgctgccagaaattgtgtcccaaattctatctgtatcaataca
cggggatcatacaagtgcggagcttgtaaacctggctttgttggggatcaaatcactggc
tgcaagagccagacggggagactctgccctaacggtcaagtcagcccatgccacgagaaa
gcacagtgcatcgtggagcgggatgggtccatctcctgcgcgtgccttgtggggtgggca
gggaatggctacatctgtgggaaggatacagacattgacggagtccctgatgaaaagctg
cgctgctctgacaagaagtgccgcaaggataactgcatgactgtccccaactctggccag
gaggatgcagacagggatggaattggagatgcctgtgatgatgatgctgatggagatggg
atattaaatgctgaggacaactgtgtgtacacacgcaatgcagaccagcgcaatgcagac
aaggataactttggtgatgcctgtgacaactgtcgtctagtgaagaacgatgaccagcgg
gacattgatggtgatgggaaaggagatgagtgtgatgatgacatagatggagatgggatc
agtaatgcaagggacaactgtagaagagttcctaaccctgatcaaaaagatagtgatggt
gatggagtaggagatatatgcgacagctgcccaacagtcagtaacccagaccagaaagat
actgatcatgatctagtgggagatgtctgtgacaccaaccaggacagtgatggcgatggc
caccaagatacaagagataactgcccatcagtgcctaacagctcccaggtggacacagac
aacgatggactaggagatgaatgtgatgatgatgatgacaatgatgggattccagatgag
aaacctccaggccctgacaactgtcggcttgtccctaaccctggccaagaagattcagat
ggtgacggtgtaggaaatctttgcgaagatgactttgacagagacatggtgattgacagg
attgatgtgtgcccagagaacgcagaagtgacgctaacagacttcagggctttccagaca
gttgtgttggaccctgagggtgatgcacagattgaccccaactggattgtccttaaccag
ggcatggaaattgtccaaaccatgaacagtgatcctggcttggctgtaggttatacagca
ttcaatggagtggactttgagggcacattccatgtcaatactgccacagatgatgattat
gctggcttcatatttggctaccaggacagttccagcttttatgtggtcatgtggaagcag
atggaacagacatactggcaggcaaaccccttccgagcagtcgcagaacctggtattcaa
ctgaaggcagtgaagtccaaaacaggcccaggtgagtatctccgcaattctctctggcac
actggggacaccacagaccaggtcaaactgctgtggaaggaccctcgcaactctggctgg
aaggacaagacctcgtaccgctggttcctgcagcatcggcctcaagttggatacatcaga
gctcgcttctatgaaggccctgaggttgtagcagacactggagttgtccttgatacaact
atgcgaggagggcgcctgggagtcttctgcttctcccaggagaacattatttggtcaaac
ctgcgttaccgctgcaatgatactattccagaagactatgaaacatttaaagttcagcaa
gactaa

DBGET integrated database retrieval system