KEGG   Gallus gallus (chicken): 420294Help
Entry
420294            CDS       T01006                                 

Definition
cylindromatosis-like
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    420294
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     420294
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C67
   420294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
2
AA seq 787 aa AA seqDB search
MTMSLLPSVGDGNCYYILTEDCAYGSKYFQAGNMCFCTERSYLRNFADVPPARFLRVIML
DDSSTVTINVGILQPVREEMAAFLLSISSHNERLNCFLERMSLEAAVQAVPGQRVMVEVD
RQHFPGVIRYVGSIQKSTLTALSPFFFGVELQGEGENRGHSDGSYLGTEYFKCKPNCGIF
LPFSRIQFIPTLDNDHGKQKPKVDAEEVVPVKVGDAVSFYVDNVRRKGIAMAVYREGTQW
FVKVCPEEEGTTDIFREIPMDAVVKEDLHSQSLFPPFESDMGVEHSKQMKQQIGESGDEC
EGVNPSLEVNSMVQITLDKGNQVSGIIRWLGYLPHTKHKMAGVELDEDKGVTAGEWLGKY
YFHCAPKRGIFVKLQSCQPDVRFQCSRNRDLNLVDYREQEDVPHAPLSFPPLRNEEAVHI
LRGRMKGIQGHCNSCYMDAALFSLFSCTSVLDSMLFTPFPLCDRNVQNILRDEIVNPLRK
NGFVMARSVMHLREQLTEKGQCSSFTNAEKDPEEFLNLIMHQVLGIEPLLRLQSGAQKEQ
DCYCYQIFMDKQEDLVVPDVQQLVEHSFLSSDLKLVEIPSCFIIQMPRFGKEYKMFSKII
PSLELDITDLLLDSPRECCVCSDVATWECSNCFKDKMFSPTGLKQFCSTCSKQVHSHYRR
KTHKPTRLRVPEEFRSRSSRGSQQVPREKMELFAVLCIETSHYVSFVKYGPENEHWMFFD
SMADRHGGENGFNIPTVTLCPEVAKYLDLPLAMLALQQPRDMDGVAKRLFCDAYMYMYQS
KKMALYK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagcctcctgccttcagtaggggatgggaactgctattacatcctgacagaa
gactgtgcctatggcagcaagtacttccaagctgggaacatgtgcttctgcaccgagagg
agctacctgcgcaactttgccgacgtgcccccagctcgtttcttgagagtcatcatgctg
gatgacagctccactgtcaccatcaatgtgggaatcctgcagcctgtgcgtgaggaaatg
gccgccttcctcctgagcatcagcagccacaatgagcgcttgaactgcttcctggagagg
atgagccttgaggcagctgtgcaagccgtgccaggccagagagtgatggtggaggtcgac
aggcaacatttccccggtgtcatccgctacgttgggagcattcagaaaagtactttgact
gcgttgtccccattcttctttggagtggagctgcagggtgagggtgaaaacagagggcac
agcgatggatcctatcttggcactgagtatttcaagtgtaagccgaattgcgggatcttc
ctgcccttcagcagaatccaattcattcccacgctggataatgaccatgggaagcagaag
ccaaaggtggatgcagaggaagtggttcctgtgaaagtgggagatgctgtgagcttctac
gtggacaatgtccgcagaaaaggaatagcaatggcagtttacagggagggaacccaatgg
ttcgttaaagtttgcccggaagaagaaggaacaactgacattttcagagaaatccctatg
gacgctgttgtgaaggaagacttgcattcccaaagtttatttccaccgtttgagtctgac
atgggagtagaacactcaaaacaaatgaaacaacagataggtgagagtggagatgagtgt
gaaggcgtgaacccgtccctggaggtgaactccatggtccagatcaccttggacaaagga
aaccaagtgtcaggaatcatccgctggttggggtacctgccccacaccaagcacaaaatg
gcaggagttgaactggatgaagataaaggggtcactgctggcgagtggctgggtaaatac
tatttccactgtgctcccaagcgtggcatctttgtgaagctgcagtcctgccagcctgat
gttcgcttccagtgctcgcgcaaccgtgacctgaacctcgtagactatagagagcaggaa
gatgttccccacgctccgctcagttttcctcctctaagaaacgaggaagcggtgcacatc
ctacgaggacggatgaaggggatccagggccactgcaattcctgctacatggatgcagca
ctctttagcctcttctcctgtacatccgtgctggactccatgctcttcacacccttccca
ttgtgtgataggaatgtccagaacattctgcgggatgagatcgtgaacccgctccgaaag
aatggctttgtaatggctaggagtgtgatgcacctgagggagcagctaactgagaaggga
caatgctcaagctttaccaatgcagagaaagatccggaggagttcctgaacctcataatg
catcaagtcctgggaatagagccactcttgagactgcagtcaggagcccagaaggagcag
gactgctattgctaccaaatatttatggacaaacaggaggacctagtggttcctgatgtg
cagcagttggtggaacactccttcctgtcttcagatctgaagctagtggagatcccatct
tgcttcattatccaaatgccacggtttgggaaggaatataaaatgttcagcaagatcatc
ccttccttagagttggatatcaccgatctgctgctggacagtcccagagagtgctgtgtg
tgcagtgacgttgccacctgggagtgttcaaattgtttcaaagacaaaatgttctcacct
acgggtctgaagcaattctgcagcacctgctccaaacaggttcactcccactaccgacgc
aaaacgcacaagccaaccaggctgcgcgtcccagaagaatttcgtagccggagctcccgg
ggcagccagcaggttccccgtgagaagatggagctctttgcagtgctgtgcattgagacc
agccactacgtctccttcgtgaaatatggccctgagaatgagcactggatgttctttgac
agcatggctgacagacatggtggtgagaatggcttcaacatccccaccgtaacactgtgc
cctgaagttgccaaatatctggacttgccactggccatgctggccctgcagcagccccga
gacatggatggagtggccaaacgcctcttctgtgatgcctacatgtacatgtaccagagc
aagaagatggcactgtataagtga

DBGET integrated database retrieval system