KEGG   Gallus gallus (chicken): 420416Help
Entry
420416            CDS       T01006                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C, delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    420416 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    420416 (PLCD1)
   04070 Phosphatidylinositol signaling system
    420416 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    420416 (PLCD1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     420416 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 759 aa AA seqDB search
MESNGTFLGCNSLKDDKDLKFLLKGSQLLKVKSSSWRKERFYKLQEDCKTIWQESKKMLR
SPDSQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFSIIFKDQRKNLDLIASSEDDANH
WVCGLGKIIAHSNSMNQKQKLQHWIHTCLRKADKNKDNKMSFKELKNFLKEVNIEVDDYH
AKEIFQYCDKSKTEALEDDEIEEFYRILTERKEIDTIFQKYSDAEGLMSCQNLVRFLYET
QQEEDAVVAAPPLIQRYEPSERAKKRNAMTKDGFLMYLLSDDGNIFNTSHRKVYQDMTQP
LSHYFVSSSHNTYLMDDQLTGPSSTEAYIRALTKGCRCVELDCWDGPNSEPIIYHGYTLT
SKILFSDVIKAIKNYAFKTSPYPVIISLENHCSLEQQKVMAQHMTTILQDMLLVAPIDGS
KSQFPSPEQLKGKILVKGKKLSRQEDPTGTNGNNNLEAEDVSDEDEAAEMEDESVKTEVQ
QKGKSDTLKLAKELSDTVVYCKSVHFNGFEDPSHPRAFYEMSSFTESKALKLAQESGNSF
ILHNIRHLSRIYPAGWRTDSSNYNPVDLWNVGCQIVALNFQTGGTEMDVYQGRFQDNGFS
GYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLLKIISGQQLPKVNKSKNSIVDPRVTIE
IHGVQQDNNKKQTKVIENNGFNPNWDEEFTFDIEIPVLALVRFVVEDFDMSTKNDFIGQY
TVPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVNIQDCD
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgaatggcactttcctcggttgcaacagcctgaaagatgacaaggacctgaag
tttctcctgaaaggcagccagctgctaaaagtgaagtccagctcttggaggaaggagcgg
ttttataagctccaggaggactgcaaaaccatatggcaggaatcaaagaagatgctgagg
tctccagactcacagatcttctctattgaagatattcgggatgtgaggtcaggccataaa
acagaaggtatggaaaaatacgccaaggatgtaccagagtatcgctgcttttccatcatt
ttcaaagaccagcggaaaaacctggacctcattgcaagttcagaggacgatgccaaccac
tgggtctgcggccttgggaaaatcatagcccacagcaactccatgaaccagaaacagaaa
ctccaacattggattcacacctgcctgcggaaagctgataagaacaaagacaacaagatg
agctttaaagagctcaagaacttcctgaaagaagtgaacattgaagttgatgactatcat
gccaaggagattttccagtactgtgacaagtccaaaacagaggctctggaggatgatgag
atagaggaattttacaggatactgacagagagaaaggaaatagacacaatattccagaag
tactcagatgcagaaggactcatgtcctgccagaacctggtgaggttcctctatgagacg
cagcaagaagaagatgctgttgttgctgcccctcccttaattcagagatatgagcccagt
gaacgagccaagaagcgtaacgccatgaccaaagatggtttcctgatgtacttgctgtct
gatgatgggaatatattcaacacctcccaccgtaaagtttaccaggacatgactcaacct
ctcagtcactactttgtatcatcctcacacaatacctatcttatggatgaccagcttaca
ggccctagcagcacagaagcctacatcagagccctcaccaaaggttgccgctgtgtggaa
ctggactgctgggatggccctaactcggaacctatcatttatcatggctacactctcacc
tccaagatcctcttcagtgatgtcattaaggccatcaagaactatgctttcaaaacttcg
ccataccctgtcatcatctccctggagaaccactgcagcctcgagcagcagaaggtcatg
gctcagcacatgacaacgatcctgcaggacatgctcctggtcgccccgattgatggaagc
aaatcccagttcccctccccagagcaactgaaagggaagatccttgtgaaaggcaagaag
ctgagcagacaggaagaccccactgggacaaatgggaacaacaacctggaggctgaggat
gtctctgatgaagatgaagcagctgaaatggaagatgaatctgtgaagacagaggtacag
cagaaggggaagagtgacaccctcaagctggccaaagagctgtcggacacggttgtctac
tgcaagagtgttcatttcaatggctttgaggaccccagccaccctcgggctttctatgag
atgtcatcgttcacagagagcaaagctctgaaactagctcaggaatctggaaacagcttt
attcttcataacatcaggcacctgagccggatataccctgcaggctggaggacagattct
tccaactacaatcctgttgacttgtggaatgttggctgccagattgttgccctaaatttc
cagacaggaggcacagaaatggatgtctaccagggccggttccaggacaatgggttctct
gggtatgtcttaaagccggaattcctccgggatgagcaaaccaaattcaatccaaaatcc
atcacagaaggaacatgggggacaaagaagaagcttctgcttaaaatcatctctggtcag
cagctgcccaaagtaaacaagagcaaaaactccatcgttgatcctagggtaacaattgaa
atccatggtgtccaacaggataacaacaagaagcagaccaaagtcattgaaaacaatggc
ttcaacccgaattgggacgaagagtttacgtttgacatagagatccctgtgcttgccctg
gtccgatttgtggtagaagactttgacatgtcaaccaagaatgacttcattgggcagtat
actgttcccttcaccagtctgaagcaaggttaccgccacattcaccttctgaccaagaac
ggagacccgtactcctcctccaccctctttgtgtatgtcaacatccaggactgtgattag

DBGET integrated database retrieval system