KEGG   Gallus gallus (chicken): 420437Help
Entry
420437            CDS       T01006                                 

Gene name
MLL3
Definition
myeloid/lymphoid or mixed-lineage leukemia 3
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    420437 (MLL3)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     420437 (MLL3)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    420437 (MLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 5018 aa AA seqDB search
MSTEDKSLVVAVAEPPQQQQPPEPAAPPPAAAAAATDKRPRGRPRKDGASPFQRARKKPR
SRGKTAVEDEDSMDGLEAAETENTVETEVKEQSAEEDAQVEVDSTKQLTPVLQRSVSEES
ASSTASVGVEAKTSEQLCAFCYCGERSSLGQGDLKQFSPTPGYVIPWKNQPLTKSDARDS
TDGACERTPKQNSVPRKQRGQKKSRLSTSCTSVSTQTASDDQVVKFWDELSLVGLPDDID
VQALFEPTGHCWAHQRCAEWSLGVCQTEEQLSVNVDKAVVSGSTERCAYCKHLGATIKCC
EEKCTQMYHYPCAAGAGTFQDFSNLSLLCPDHIDQAPERSKEEANCAVCDSPGDLLDQLF
CTTCGQHYHGMCLDIQVTPLKRAGWQCPDCKVCQNCKHSGEDNKMLVCDTCDKGYHTFCL
QPVMDSVPTNGWKCKNCRVCAECGTRTSCQWHHNCLVCDSCYQQQDNLSCPFCDKLCLQD
FQKDMLHCHMCKRWIHMECDRSPGIELESQLKDYICTLCKQGEGDQTQSCDVMDTSELIP
EPASIAGCTNEMEMESGGEDVAFQEQLVIGNGPGQESAVGCVTDVTGISPEEKTTELETE
VSNEVNSAEMEMSPKKTPASDDSHTEKMMEVMEGVEAVSQQELGKQVEEAQLLQGSAEVS
EVATVDSRSLSSVPETITVMPEIEGAEGKGGVCIHAEQQLEIIKVQKEVEKGETLEKSET
PALLEVETASVNEGVTNSSPVVDKPIKSPAETYPSLPPSVNISKANVSSSVDLHSAREVQ
HAQPPAPPSTAGSALPTTYISVTPKIGMGKPAITKRKFSPGRPRSRQGAWSTNNTVSPPS
WSPDISEGRDIFKSRQLPGSAIWSIKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKNGVG
TVVIPGVTTMDISSNKDEEENSMHNTVVLFSNSDKFTLHQDMCVVCGSFGQGAEGRLLAC
SQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCL
DPPLQTVPKGGWKCKWCVWCRHCGATSPGLRCEWQNNYTQCAPCASLSTCPICYRTYRDE
ELIIQCRQCDRWMHAICQNLNTEEEVENIADMGFDCTICRPYIPPTNVPSLDCCDSSVGA
QIISKSKELDPPKTYTQDGVCLTESGMSQLQSLTVTVPRRKRTKPKLKLKIINQNSVAVL
QTPPDAQSEHSRDGEMDDSREGDLMDCDGKSDSSPEREAVDDDTKVAEGADGIKKRKRKP
YRPGIGGFMVRQRSRTGQGKTKRSLSRKDSSGSVSEQMPGRDEGWTEQLPDTPVEESTPA
SESTEKIKKRYRKKKNKLEETFPAYLQEAFFGKDLLDTSRQNKMSLDNLPEESLPLSCKA
NLATSFLDPSSDPLLSSTSTPAQAKLGPQGSTDDPLADLSEVLNTDDDILGILSDDLVKS
GDHSGLDLCTFQVENSPSPFAGLDIGPISDDPSSLPQPNVNPTSRPLSEEQLDGILSPEL
DKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPATTQTAPLPQPPPPPQLMSLHSQGES
AFPRVPLMNGLIGPNPHLPHTALTPGGGLGTFSPITQPPYTDTRDKNPAFNPMVSDPNSS
WAPSAPPLEGEGDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWATR
VKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSD
LFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQQQQFGS
QQLLNQSGSDTPSSGIQSPLTPQAGSGSMSPAQQTFHKDLFAKQQLPATPTSASSDDVFL
KPQAPPPTPTRIPVHDSLSQSQTPQTSSQQMFSPGSTNTRPPSPMDPYAKMVGTPRPAPT
NQNFVRRGSIAPLDTCAPQSSISRPVQVTEPSGSRPSPVRDSCSSSPSSSDPYAKPPDTP
RPVMTSDQFSKPLGVPRSPMVMDQSGKVPLAAGSSDPFTKPAPRTDAFQRQRVTSADAYA
RPPLTPTPAPVDGSPGHFKTPMRPPQSPQDPYASMPATPRRVAVDPYERPALTPRPVDNF
SHNQPNDPYSQPPLTPHPAIKESFAHPPRIVRQQSESFPQSGPISRPASQDPYSQPPGTP
RPVADPYAQPPGTPRPAAVDPYMQQPPTPRPAQPADLFAQSPTNQRHSDPYAQPPGTPRP
VLNDPYSQQPATPRPGIPESFNRPAMTRPGLIPNRDPFLQTSQNRLQGTFVRPSDPCSQT
PRPAGPAITDSFNHGPSAPARDLYDQPPMTPRPQPESFGTGQLAHDAAEQSRPGAEGNFS
ASANSTMSSQGQQFPKVSQGPGPAPTTGVTDTQNTMNMSQADTEKLRQRQKLREIILQQQ
QQKKNAVRQEKALQDPAAPPHATPLQHWQQDNLNQIFNRPPPPYPGNIRSSVVPPGGPRF
TVYSKDQRGPFPGDGQFNRPQFPGDMSTMGMRPHGLRFGFPGGGHGPPSGQERFLSPQQA
MQRAGVPPQLRRSLSIDMPRPVSNPQINSASGISQHFPPQGIQVQQHNILGQAFIELRHR
APDGRPRLPFNPSAPNIMDPAVQHQRHAGFIPRQEFPGPRQAEPLRHNSQGMPNQLQMPA
GLEHMSQPQQDQINPDNPPALVIRSISNPPVADAFSGPSLPTSAPSDESANMQIPNQSSD
GLEEKLDPDDPAVKDLDVKDLDGVEVKDLDDEDLENLNLDTEDGKGDELDTLDNLETNDP
HLDDLLRSGEFDIIAYTDPDLDVGDKKGMFNEELDLSVPIDVKLDIQGKTEETKEEQGDR
TVAHSETLSSPKKSTTENEIKTEILSPNTHEEKKNENERSDGNAESTSIQQATETELKDG
EKAPAQPPNLEFPDKTTAVSSQETTVPSPDTQGSAPVPVQGAVSSCSISGSTPVLSSLLA
NESSDNAETRTLASPSQSLPTTQLNHASGIPQTLLTPGGQILENTLNSNLTMVPRINHSF
SQGSPNPGFIQGQAANHNFGAGQASNQTVAVTSRPGPSGISGPQQIMLPQPLAQQQNRER
PLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVAL
KGINKVMAQSNMGMPPMVMNRFPFMGQPVPGAQANEGQNHMQQAITQDGSLTPQISRPNP
PNFGPGFVNDSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGR
EFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEEYRIKQQQQQQQCGMAPHAIM
PGVQAQPPMVPAGTSPAMNQQNFPMVAQQLQHQQHPVVIPGQSNPARMPNISGWQSTNPS
AGHISINPARMQPPMTPLPITPGTAAPVPGPNATAQSGPPPRVEFDDNNPFSESFQERER
KERLREQQERQRIQLMQEVDRQRALQQRMELEQHGMIGSELNNRASLSQIPFFNSDLPCD
FIQTPRPLQQSPQHQQQQIGQMLQQGPVNSPPATNFLQSSERRPVGPTAFGPDASAVPGG
SSNFHNVKQTHGNLPGATFTQNQVRPPFAPAVPPSTVPSSAALSSGAPCGSDTSVPQGAN
FPGSSQSLIQLYSDIIPEEKGKKKRTRKKKKDDDAESLKAPSTPHSDITAPSTPTVSDST
STPTVNTPSELPHHQDEQESVEVTGPSTSNAPESQASPELECQLPSSSLPPKQPNVSTET
DRAKPGTPTGIQEVKLEKAETDQCSDQTEPKTENQSTVKVEEDKVPSQPPSSAQSPAQPA
SVPAAKGESGNELLKHLLKNKKSSSLLNQKSESSCRTEEEAAGEKRLTDKQNPAEGMQTA
GNQMQGAFGCSNSQLQRADVGHETKKQRNKRTQRTGEKAAPRSKKRKKEEEEKQAIYPNA
DTFIHLKQQLSLLPLMEPIIGVSFAHFLPYGSGQLNAGNRLVGSFGSATLDGASDYYSQL
IYKQNNLSNPPTPPASLPPTPPPVACQKLVNGFATTEELAGKAGMLGGHDVTKALGPKQF
QLPFRPQDDLLARAMAQGPKTVDVPASLPTPPHNNQEELRVQDHCEDRDTPDSFVPSSSP
ESVVGMEISRYPDLSVVKEENPEPVPSPIIPILPSSTGKGSEAKRNYIKAEPGSGALPGS
AFFASQLGPPQNGPKSGLISVAITLHPTAAENISNVVAAFSNLLHVRIPNSYEVSNAPDV
PSSMAAVSSHRVNPSAEYRQHLLLQGPQAGSMGPARIAGSYGLKQPNMPFAANSNGIAGY
KDHSQNIAESSALRPRWCSHCKVVVLGSGVRKSFKDLPFLKQDSQDGSDKMKDIVFCSNN
CFVLYSAALQAKNSENKESVSSLPQSPMKERPPKAFHQYSNNISTLDVHCLPQLQEKVSP
SSSPPIIFPPAFEAAKVEAKPDELKVTVKLKPKLKAIHSSLDDCRSPSKKWKGMKWKKWS
IQIVIPKGSFKPPCEEEIDEFLKKLGTTLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLN
LDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCMFCHKMGATSGCHRLRCTN
IYHFTCAIKAQCMFFKDKTMLCPMHKPKGTHEQELSYFAVFRRVYVQRDEVRQIASIVQR
GERDHTFRVGSLIFHAVGQLLPQQMQAFHSSKALFPVGYEASRLYWSMRYANRRCRYLCS
IEEKDGLPLFVIKVVEQGHEDLVLTDTTPKGVWDKILEPVASVRKESEMLQLFPSYLKGE
DLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAINPTGCARAEPKMSTHVKR
FVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQ
GLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHVIDATLTG
GPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEEVRPSHLAFPHCCHLCSFVDP
ATVRCGCVGWGGDIALPLSILTLAGSYEEHCCILPSKL
NT seq 15057 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacggaggacaagagcctggtggtggcggtggcggagccgcctcagcagcagcaa
ccccccgagcctgcagctccccccccagcagcagcggcagcagccacagacaaaagacct
aggggccggcctcgcaaagatggcgcttcccctttccagagagccagaaagaagcctcgg
agtagaggaaaaactgcagtggaggatgaagacagtatggatggtttggaggcagcagaa
acagaaaacactgtggaaacagaagtcaaagagcaatctgcagaagaggatgcccaggtg
gaagtggacagcaccaagcagctaacaccagtccttcagcgctcagtatctgaggagtct
gcaagctccactgcctccgttggtgtcgaagctaaaaccagcgaacaactctgcgccttt
tgttactgtggtgaacgaagctcattaggacaaggagacttaaaacaattcagcccaact
cctgggtacgtcatcccatggaagaaccagcctttaaccaagagcgacgcccgcgacagc
accgatggagcttgcgagaggactccaaagcaaaactcagtgccgcgcaaacagagagga
cagaaaaaatctcgattgagtacatcatgtacgagtgtcagcacccaaactgcttctgac
gatcaggttgtcaaattctgggatgaactcagtttagttggcttaccagatgacattgat
gttcaagccttatttgagccaacaggtcattgctgggctcatcaacgctgtgcagagtgg
tcactgggagtctgccagactgaagagcagctatcggtgaacgtggacaaagctgttgtc
tcagggagcacagaacgatgtgcatattgtaagcaccttggagccactatcaaatgctgt
gaagagaaatgtacccagatgtaccattacccctgtgctgctggagcaggcacatttcag
gatttcagtaacttgtccctcctttgtccagaccatattgatcaggctcccgaaagatca
aaagaagaagcaaattgtgcagtgtgtgacagccctggagacctcttagatcaacttttt
tgtacgacctgtggccagcactaccatgggatgtgcctagacatacaagttacaccttta
aaacgagcaggttggcagtgtcctgattgcaaggtgtgccagaactgcaaacattctggg
gaagacaacaagatgctggtgtgcgatacatgtgacaaagggtaccatacattctgtcta
caaccagttatggactctgtaccaacaaatggttggaaatgtaaaaactgtagagtatgt
gctgagtgtggaacacgaacaagttgtcagtggcaccataattgtttggtatgtgacagt
tgttaccaacaacaagacaacttatcttgtcctttctgtgacaaactgtgcctgcaagac
ttccagaaagatatgttgcattgtcacatgtgcaaaaggtggattcacatggaatgtgac
agatctccgggtattgaattggagtctcagctgaaagactacatctgtactctctgtaaa
caaggagaaggggatcagactcagtcttgtgatgtaatggatacttctgaactcattcct
gaacctgccagcatagcaggctgtacaaatgaaatggaaatggaaagtggtggagaggat
gtggcatttcaggaacaacttgtcattggtaatggccctgggcaagaatcagctgttgga
tgtgtcacagatgttacaggcatatcaccagaagaaaagaccacagaactggaaacggaa
gtctctaatgaagttaattctgctgaaatggaaatgtctcctaaaaagacaccggcatct
gatgacagtcatactgagaaaatgatggaagtgatggaaggtgttgaagcggtgtcacag
caggagttaggcaaacaagtggaagaggcacagctactgcaaggtagtgctgaggtatca
gaagtagccacggtagactctcggtctctgtcttcagtacctgagaccataactgtgatg
ccagaaatagaaggggctgaaggcaaaggaggtgtttgtatccatgcagagcaacaactg
gaaataataaaagtgcaaaaagaggtagaaaaaggagaaacccttgaaaagtcagaaaca
ccagctcttcttgaagtagaaactgcttctgtaaatgaaggtgttacaaacagttcacca
gttgtggacaaacccataaaatcaccagctgagacttacccctcgcttcccccatcagtt
aacataagcaaggcaaatgtgtcttcctcagtggacttgcattctgcacgagaagtacag
cacgctcagccgccagcaccgccttccactgctggaagtgctctcccaacgacttacata
tcagtcactccaaaaattggcatggggaaaccagccatcaccaaaaggaaattttcccct
ggaagacccagatcgagacagggggcttggagtaccaataatacagtcagcccaccttcc
tggtccccagacatttcagaaggtcgggacatttttaaatccagacagcttcctggcagt
gccatttggagcatcaaagtgggccgtggatcaggattcccagggaagcggaggccacgt
ggtgcaggtctttcaggacgaggtggcagaggcagatcaaaactgaaaaatggagttggg
actgtagtcattccaggggtcacgactatggatatttcgtctaacaaagatgaagaagaa
aactcaatgcataatacagttgtcctcttctctaacagtgacaagttcactctccatcag
gatatgtgcgtagtttgtgggagttttggccaaggtgctgagggcaggttgcttgcctgc
tctcaatgcggtcagtgttaccatccatactgtgtcagtattaagattactaaagtggtg
cttagtaaaggctggaggtgcctggagtgcactgtatgtgaagcctgtgggaaagctaca
gacccaggaagactacttctctgtgatgactgcgacatcagttatcacacttactgccta
gatccacccctgcagactgttccgaaaggaggctggaagtgcaaatggtgcgtttggtgc
agacactgtggagcaacttcaccaggtttaagatgtgaatggcaaaataattacacgcag
tgtgctccctgtgcaagtttgtctacctgtccaatctgctatcgcacttacagggatgaa
gagcttataattcagtgtaggcaatgcgatcgatggatgcatgcaatctgtcagaactta
aacacagaggaggaagtggaaaacatagctgatatgggttttgactgtaccatttgtagg
ccatacataccaccaacaaacgtgccttctttggactgttgtgattcatcagttggagct
cagattatttcaaaatcaaaagaactagacccaccgaagacatatacacaggatggagtc
tgcttgacagaatccggcatgtctcagttacagagcctaactgtcacagtacctagaaga
aaacggacgaaaccaaagcttaaattgaagattataaatcagaacagtgtggctgtgctt
cagacacccccagatgcccagtcagaacactcaagagatggcgagatggatgacagtaga
gagggtgatctcatggattgtgatgggaaatctgactccagcccagaacgggaagctgtg
gatgatgataccaaagtggcagaaggagctgatgggattaaaaaaagaaagcgaaaacca
tacagacctggtattggtggatttatggtacgtcaaagaagtcgtacagggcaggggaag
actaagagatctctctctaggaaagattcttctggatctgtttctgagcagatgcctggc
agagatgagggctggacagaacagttgcctgacactccagttgaggagtctactccagct
tctgaaagtactgagaaaataaaaaaacgttacaggaaaaagaagaataaacttgaagaa
acttttcctgcctacttgcaggaagctttctttggcaaagatctactagatactagtaga
caaaacaagatgagccttgataatttacctgaagaatcacttcctctctcatgtaaagcg
aatttggccaccagtttcctggatccttcatctgaccctcttcttagctcaacctccact
ccagctcaggcgaaactgggacctcaaggtagcaccgatgaccccttagctgatctttct
gaagtcttaaataccgatgatgatattcttgggatcctttctgatgatttggtaaagtct
ggagatcattcgggtcttgatttatgcactttccaggttgagaactcaccctccccattt
gctggattggatattggtcccatctctgatgatccttcttctctgcctcagccaaatgtc
aacccaacttcacggccactgagtgaagaacaattggatggaatcctcagtccagaacta
gacaaaatggtcacagatggtgctattcttggcaaattgtacaaaatcccagagctggga
ggaaaagatgtcgaagatctgttcactgctgttctaagtccagcaaccacacagacagct
cctttgccacagcctccacctccaccacagcttatgtctttgcacagtcagggagagagt
gcatttccaagagtgccacttatgaatggtctgattggccctaaccctcatctccctcat
acagctctgactcctggaggtggcctgggcactttctctcccataacacaaccaccatat
actgataccagggataagaatccagcattcaatccaatggtaagtgatccaaacagctca
tgggcaccatctgctccacctttggaaggtgaaggtgatacgatgtccaatgctcaaaga
agtactcttaagtgggaaaaagaagaagcattgggtgaaatggcgacggtagcacctgtt
ctctatacaaatattaacttccctaatctaaaggaagaatttccagactgggctacaaga
gtgaagcagattgctaaattgtggaggaaagcaagctcgcaggagagagctccatatgtg
caaaaagccagagataatagagctgctttgcgcatcaataaagtacagatgtcaaatgac
tccatgaaaaggcaacagcaacaggatagcattgatcccagctcacgtattgactccgac
ctctttaaagatccattaaaacagagggaatcggaacatgagcaggagtggaaattcaga
cagcaaatgcgtcaaaaaagtaagcagcaagccaaaatagaagccacgcagaagcttgaa
caagtgaaaaatgagcagcagcaacagcagcagcagcagcaacagcagcagtttgggtca
caacagcttctgaaccagtctggctcagatacgcccagcagtgggatccagagtcccctc
acacctcaggctggcagtggcagtatgtctcctgcacagcaaacattccataaggatcta
tttgcaaagcagcagctacctgctacacctacttcagcatcctcagatgatgtgttcctc
aaaccacaagccccaccccctactccaacccgaatcccagtacatgattcactgtctcag
tctcagactcctcaaacatcatcacaacagatgttttctccaggttccacaaacacaaga
ccaccttccccaatggatccatatgctaaaatggtaggaacacctagaccagcacctact
aatcaaaactttgttagaagaggtagcattgcaccgttagatacctgtgcaccacagtca
tctatatccaggcccgttcaggtaactgaaccatcaggaagcaggccttcaccagtcagg
gattcatgttcttcatctccaagtagcagtgatccctatgcaaagccaccagacacaccc
aggcctgttatgacctcagatcagttctccaaaccattgggggtcccaagatcacccatg
gttatggatcagtcagggaaggttcctttagcagctggaagcagtgatccgttcacaaag
ccagctcctagaactgatgcatttcagagacagagagtaacttctgctgatgcatatgca
cggccaccattgactcctactcctgctcctgttgatgggagccctggacactttaaaact
cccatgcgcccacctcagtccccacaagatccctatgcatcaatgccagctacaccaagg
cgcgttgctgttgatccatatgaaaggcctgcactgacaccgaggccggtggataacttt
tcccataatcagcctaatgatccatacagccagcctccccttactccccatccagcaata
aaggaatcttttgcccatccaccccggatcgtgcggcaacagagtgagtctttccctcag
tctggacccatttcaaggccagcttctcaggacccttattcccagcctccaggtactcct
cggccagttgctgatccttatgcccaacctccaggaactcctcggcccgccgcagttgat
ccatatatgcagcaaccacccacaccaagacctgcacagccagcagatttgtttgctcag
tctccaacaaatcagagacattctgatccatacgctcaacctcctggaacaccaaggcca
gttctgaatgatccttattctcagcaaccagcaactccaaggccaggaataccagagagt
tttaacagacctgcaatgacaagaccgggactaataccaaatagagatcctttcctgcag
acatcacagaacaggttgcagggcacttttgtcaggccatcagacccatgttctcaaact
cccagaccagcaggacctgcaataacagattcatttaaccatggtccttctgctccggca
cgcgatctttacgatcaaccaccgatgactccaagacctcagccagaatcttttggaact
ggtcagctagcccatgatgctgctgagcagtcacggcctggagctgagggcaacttcagt
gcgtctgcaaattctacaatgagttctcaaggacagcagttccccaaagtttcacaaggt
cctggcccagcacccactacaggagtaacggatacacagaataccatgaatatgtctcaa
gcagacactgagaaattacgtcagagacagaaattacgtgaaattattctgcaacaacag
cagcaaaagaagaatgcagttcgtcaggaaaaagccttacaggatccagcagctcctccc
catgcaactcctctccagcactggcagcaagacaacttaaatcagatttttaaccgccct
cctcctccatatcctgggaatattagatcctctgttgtccctccaggtgggccaaggttc
acagtatactcaaaggatcaacgtgggccatttcctggtgatgggcagttcaatagaccc
cagtttccaggagatatgagcaccatggggatgagacctcatggtcttaggtttgggttt
ccaggaggtggccatggtccaccctcaggccaggagcgtttcctcagtcctcagcaggca
atgcaacgtgctggagttccaccacaattgagaagatctctgtctattgatatgcctcgg
ccagtgagcaatccacaaataaacagcgcatcggggatctcccagcattttcctccacag
ggaattcaggttcagcagcacaatatattgggtcaggcatttatcgagttgcgtcacagg
gctcctgatgggaggccaaggctgccttttaatccttctgcaccaaacattatggatcca
gcagtgcaacatcagcgacacgcagggtttatacccaggcaggaatttccaggcccgaga
caggcagaaccactgagacataattctcagggtatgcctaaccagttgcagatgcctgca
ggattggagcatatgtcacaaccccagcaggatcaaatcaaccccgacaacccacccgca
cttgtaatacgttctataagcaatccaccagtagctgatgctttctcaggaccgtctttg
cctacatctgcaccgagtgatgaatcagcaaatatgcagattcccaaccagtcaagtgat
ggtctggaagaaaagcttgatcctgatgatcctgctgtgaaagatttggatgtgaaagac
cttgatggggttgaagtcaaggatttggatgatgaagatctcgaaaatttgaatctagac
acagaggatggaaaaggggatgagctggacactttagataacttggaaaccaatgatcct
caccttgatgaccttctaagatctggggaatttgatataattgcatacacagacccagac
cttgatgtgggggataagaaaggaatgtttaatgaagaactagatcttagtgtccccatt
gatgtcaagctggatatccagggcaagacagaagaaacaaaagaggagcaaggggataga
actgttgcgcattctgagaccctgtcttcgccaaagaaatctactacagaaaatgaaata
aaaacagaaatactttccccgaacactcatgaggaaaagaagaatgaaaatgaaagaagt
gatggaaatgcggaatcaacaagtattcaacaggctactgaaacagagttaaaagatgga
gaaaaggctcctgcgcagcctcctaacctagaattccctgacaaaactactgctgtttcc
agtcaagaaacaactgtgcctagtccagatactcagggatctgctccagtgcctgttcaa
ggagcagtaagttcctgcagtatttctgggtccacaccagtcctctcaagtttgctagct
aatgaaagctcagataacgccgagacaaggacgctagcatctccctcgcagtctttgcca
acaactcaactgaaccatgcatcgggtattcctcaaacactactgacacctggtggacag
atcttggaaaacactttaaattccaatctgaccatggttccacgaataaaccatagtttt
tctcaagggtcaccaaacccaggatttattcagggtcaggcggccaatcataacttcggg
gcagggcaggcatctaatcaaactgtggctgtaacaagccgtcctggcccgagtggcata
tctggtccccagcagataatgctccctcagccattagctcagcaacaaaatcgagagagg
ccattactgctagaggaacagccccttcttctgcaggatcttttggatcaggaaaggcag
gagcagcagcagcagcggcagatgcaagccatgattcgccaacgttcagagccatttttc
cccaatattgacttcgatgcaattactgatcctataatgaaagcaaaaatggtagctctc
aaggggatcaataaagtcatggctcagagtaacatggggatgccaccaatggttatgaac
aggtttcctttcatgggtcagccggtgcctggggctcaggccaacgaaggccaaaatcac
atgcagcaggcaattacacaggatggaagtttgacacctcagatttctagacctaatcct
cctaattttggtcctggttttgtcaatgattcacaaagaaagcagtacgaggaatggctg
caagaaacacaacagcttcttcaaatgcagcagaagtaccttgaggagcaaattggagca
cacaggaaatcaaaaaaagcactctcagcaaaacaacgtacagccaaaaaagctggccgg
gagttcccagaagaggatgcagaacagcttaagcacgttacagagcagcagagtatggtc
caaaaacagcttgaacagattcgaaagcaacagaaagaacacgcagaactaattgaggaa
tatcgaatcaagcagcagcagcagcagcagcagtgtggaatggcaccccatgctataatg
ccaggagtccaggctcaaccaccaatggtcccagcaggaacatcaccagcaatgaatcag
caaaacttccccatggtggcacaacagctccagcatcagcagcatcccgtggtgatcccg
gggcagtccaaccctgccagaatgcccaatatttctggatggcagtctacaaatccctct
gcaggccatatttccattaatccagcaaggatgcagcctccaatgacgccgctgccaatc
actcctggtacagcagctcctgtgcctggtccaaatgcaactgcacagtcaggaccacca
ccaagggtggagtttgatgacaataacccttttagtgaaagtttccaagagcgggaaaga
aaggaacgtttacgggagcagcaggaaaggcaacgcattcagcttatgcaggaggtggac
cgacagagggctttacagcagagaatggaactggaacagcatggtatgatagggtctgaa
ttaaataacagagcatccttgtctcagatacctttcttcaattccgatctgccttgtgat
ttcatacaaactccacgtcctcttcagcagtctccacagcatcaacagcagcaaattgga
cagatgctgcaacaaggtcctgtgaactcacctcctgccacaaatttcttgcaaagcagt
gagcggagaccagtgggacctacagcttttggacccgatgcatctgctgttccaggcgga
tcctctaatttccataatgtaaaacaaactcatgggaatcttcctggggccacctttaca
cagaaccaggtcaggcctccatttgctcctgctgtacctccatctacagttccttcatct
gcagcactgagcagtggtgccccatgtggttcggacacaagtgtgccccagggagcaaac
ttccctgggtcgagccagtccctcatacagctgtattctgacataattccagaagagaaa
ggaaaaaagaaaaggacacgaaaaaagaagaaggatgatgatgctgagtcattaaaagcc
ccatcgactccacattcggatataactgcaccatcaactccaactgtttctgattctacc
tctacccccacagttaacacccccagtgaactgcctcatcatcaagatgagcaagagtca
gtggaggtaacaggtccatcaacctcgaatgcaccggagagccaggcctctccagagctg
gagtgtcagctccccagcagcagcttaccaccgaaacagccaaatgtgagtacagagact
gacagggccaaaccaggcacacctactggcattcaggaagttaaactagaaaaggcagaa
accgatcagtgctcagatcaaactgagccaaaaacagaaaatcaaagcactgttaaggtg
gaagaagataaggtcccatcgcagcctccctcttcagctcagagtccagcacagccagct
agcgttccagcagccaaaggggagtcagggaacgagttgctgaagcacctgcttaaaaac
aaaaaatcctcatctcttctgaaccagaaatcagagagtagctgtcgaacagaagaggag
gctgctggagagaagaggttaacggacaagcagaatccagctgaaggaatgcaaactgca
ggaaaccagatgcaaggtgcatttgggtgtagtaacagccagcttcagagagcagatgtg
ggacatgaaaccaagaaacagagaaataagcgaactcagaggacaggagaaaaggcagct
cctcggtccaagaaaaggaaaaaagaggaggaagaaaaacaggctatataccccaatgct
gatacgttcatccatctcaaacaacagctttctctcctacctttgatggaaccaataatt
ggagtgagctttgcacactttcttccctatggcagtggccagctaaatgctggaaatcga
cttgtaggaagttttggtagcgctacccttgatggggcttcagattactactcccagctc
atatacaagcagaacaatctgagcaatcctccaacgcccccggcctctcttccacccaca
ccccctcctgtggcatgccagaagttggtgaatggctttgcaaccactgaagaacttgct
ggcaaggctggtatgttgggaggccatgatgttaccaaagctctgggaccaaagcagttc
cagttacctttcagaccacaagatgatttattagcaagagcaatggctcagggccctaaa
actgtggatgttcctgcttcccttccaacaccacctcacaacaatcaggaggagttaagg
gttcaagatcactgtgaggacagggacactcctgacagctttgttccatcttcctctcct
gaaagtgtggtgggaatggaaataagtaggtatccagacttgtcagttgtaaaggaggag
aacccagaacctgtaccatctcccatcattcccatcctacctagcagtactggaaaaggt
tcagaagccaaaaggaattacataaaggcagaacctggttcaggagcattacctggttct
gccttctttgcctctcagcttggaccaccccagaatggtcctaaatctggccttatttct
gtagcaattaccttacatcccacagctgctgagaatattagcaacgttgtggcagcattc
tccaatttgctgcacgtccgaattcccaacagttacgaggtcagtaatgctccagatgtg
ccatcctccatggcagcagtcagcagtcacagggtgaacccatctgcagagtaccggcag
cacttactgctccaggggcctcaggcaggatccatgggtcctgccaggattgcagggtct
tatggactgaagcagcccaatatgccatttgctgcaaacagcaatggtatagctggctat
aaggatcacagtcagaatattgcagaaagctcagcactgcggcctcgatggtgctctcat
tgcaaagtagttgttcttggcagcggtgtgcggaagtccttcaaagacctgcctttcttg
aaacaggattcccaagatgggtctgataaaatgaaggacatcgtattctgtagcaacaac
tgctttgttctctattcagcagctctgcaagcaaaaaactcagagaacaaagagtcggtt
tcatctttgccacagtcaccaatgaaggagaggccgcctaaagcattccatcagtacagc
aacaacatctccactttggatgtccactgcctgcctcagttgcaggaaaaagtgtctcca
tcatcttcacccccaattattttcccccctgcatttgaagcagccaaggtagaggcgaaa
ccggatgagcttaaggtaacggtgaaactcaaacctaagttaaaagcaatacacagcagt
cttgatgactgtcggtctccgagcaagaaatggaaagggatgaagtggaagaagtggagc
attcagattgtgattcctaaaggatcattcaaacctccttgtgaagaagaaatagatgaa
tttcttaagaaattgggcacgacccttaaaccggacccagtgcctaaagactacagaaaa
tgttgcttctgtcacgaggaaggcgatgggttaactgatggaccagcaaggcttcttaac
ctggatttagacctttgggtccatttgaactgtgctctttggtctacagaagtctacgag
acacaagctggtgccttaataaacgtggaactagccctgcgaagaggcttgcaaatgaaa
tgcatgttctgtcacaaaatgggtgccaccagcggttgtcacaggttaaggtgcaccaat
atttatcactttacctgtgccattaaagcacaatgcatgttttttaaagacaagaccatg
ctttgccccatgcacaaaccaaagggaactcacgagcaggaactcagttactttgcagtc
ttcaggagggtctatgtgcagcgcgacgaggtgaggcagatcgccagcatcgtacagcgg
ggagaacgcgaccacactttccgggtggggagcctgattttccacgccgtgggtcagctg
ctcccacagcagatgcaggcctttcactcctccaaagcgctcttccctgtgggttatgag
gccagcaggctgtactggagcatgaggtacgccaacaggcgctgtcgctatctctgttcc
attgaggagaaggatgggctcccgttgtttgtcatcaaggttgtggagcaaggccatgaa
gatctggttcttactgacacaacgccaaaaggtgtgtgggataaaatcctggagcccgtt
gcttcagttaggaaggagtcagaaatgctgcagctgttccccagctatctgaagggcgag
gacctctttggtttgacggtgtctgcggtggcgaggattgcggagtcgctcccaggggtt
gaggcctgtgagaactatactttccgctatggccgaaaccctttaatggaacttcctctt
gccatcaaccccacgggctgtgcccgtgccgagcctaaaatgagtacccatgtcaagagg
tttgtgttaaggcctcacaccttgaatagcaccagcacatcgaagtcatttcagagcaca
gtcacaggggagctgaacgcgccttacagtaagcagttcgtccattccaagtcctcccag
taccggaaaatgaaaacagagtggaagtccaatgtgtacctggctcgctctcgcattcag
ggcctgggcttatatgctgctagagacattgaaaagcacactatggtcattgagtacatc
ggaactattatccggaatgaggtagcaaacaggaaggagaagctttatgaatctcagaac
cgcggggtgtacatgttccgcattgacaacgaccacgtcatcgatgctaccctgacggga
ggtcccgcaaggtacatcaaccactcgtgtgcccccaactgcgtggcggaggtggtcact
ttcgagagaggacacaaaattatcattagctccagcaggagaatccagaaaggggaggag
gtacggccgtctcatctggctttcccccactgctgccacctctgttcatttgtagatcct
gccacagtgcggtgtggctgcgttgggtggggaggtgacattgcccttcccctttccatt
ttaactcttgccggttcctacgaggaacactgctgtattttaccatctaaactgtag

DBGET integrated database retrieval system