KEGG   Gallus gallus (chicken): 420574Help
Entry
420574            CDS       T01006                                 

Gene name
ASNS
Definition
(RefSeq) asparagine synthetase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00250  Alanine, aspartate and glutamate metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    420574 (ASNS)
Enzymes [BR:gga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     420574 (ASNS)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C44
   420574 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 420574
NCBI-ProteinID: NP_001026148
CGNC: 7411
Ensembl: ENSGALG00000009748
UniProt: Q5ZJU3
Position
2
AA seq 561 aa AA seqDB search
MCGIWALFGSDECLSVQCLSAMKIAHRGPDAFRFENVNGFTNCCFGFHRLAVVDQLYGMQ
PIRVKKFPYLWLCYNGEIYNFKQLQEQFGFEYQTLVDGEVILHLYNRGGIEQTASMLDGV
FAFILLDTANRKVFLARDTYGVRPLFKVLTDDGFLGVCSEAKGLINLKHSTSLFPKVEPF
LPGHYEVLDLKPSGKVVSVEVVKFHSYKDEPLHAACDTVGNLPSGFDLETVKSNIRVLFE
NAVRKRLMAHRRIGCLLSGGLDSSLVAAVLLKLMKEMNIKYPLQTFAIGMENSPDLLAAR
KVAAHIGSEHHEVIFNSEEGIQAVEEVIFSLETYDITTVRASIGMYLVSKYIRKKTDSVV
IFSGEGSDELTQGYIYFHKAPSPEEAAEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFTSYYLSLPAELRIPKNGIEKYLLRQSFEDSNLLPKEILWRPKEAFSDGIASVKKS
WFSILQDYIDQQVDDLLLEKAAEKYPFNPPRTKESYYYRQIFEKHYPGRSSWLPHYWMPR
WVEATDPSARTLKHYKSAIQE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatctgggccttgtttggaagtgatgaatgcctttctgtccagtgtctgagt
gccatgaagatagcacatagaggtcctgatgcatttcgttttgagaatgtcaatggattc
accaactgttgttttggtttccaccgcctcgcggttgttgaccagctgtatggcatgcag
ccgatccgggtgaagaagttcccttatctgtggctgtgctacaatggagaaatctacaac
ttcaaacagttgcaggagcagtttggatttgagtatcaaacattggtggatggtgaggtt
atccttcatctttacaacagaggaggaatagagcaaacagcatctatgctggatggtgta
tttgctttcatccttctggacacagcaaacagaaaagtgtttctggcaagagacacctat
ggagtcagaccactgtttaaggtgctgactgatgatggatttttgggtgtctgttctgag
gcaaaaggacttataaacttaaagcattcaacatccttatttcctaaagtggaaccattt
cttcctggtcattatgaagtgctggatttgaagccctctggcaaggttgtgtcagtggaa
gtagtaaagtttcatagctataaagatgaaccactccatgctgcttgtgatacagtggga
aatctgccttcaggctttgatcttgaaacagtgaagagcaacatccgtgttctgtttgaa
aatgctgttagaaagcgtttgatggctcacagaaggatcggttgtcttttgtcagggggc
ttggattccagcttggttgcagctgttcttctgaaactgatgaaagaaatgaacataaaa
tatccactacaaacctttgcaattgggatggaaaacagtcctgatttactggctgccaga
aaggtggcagcacatataggcagtgaacatcatgaagtaatatttaattctgaagaggga
attcaggcagtagaggaggttatcttctctttggaaacctacgatataacaacagtaaga
gcttcaattggtatgtatcttgtctccaaatatatacgcaagaaaacagacagtgtggtc
attttttcaggagaaggatcagatgagttgactcaaggatatatatatttccataaagca
ccatctcctgaagaggctgcagaagagagcgagaggcttctgaaggagctctatttgttt
gatgtacttcgtgcagacagaactactgcagcacatggtcttgagctaagagtcccgttt
ttggatcatcgctttacttcttattatttatctctaccagcagaactgcgaatcccaaag
aatggaattgaaaaataccttttaagacagtcctttgaagactccaacttgcttcccaaa
gaaatactctggagacccaaagaagctttcagtgatggcatagcatcagtaaagaaatcc
tggttttctattcttcaggactatattgatcaacaggttgatgaccttctgctggaaaag
gcagcggagaaatatccattcaatcctcctagaacaaaagaaagttactactaccgtcag
atctttgagaagcactacccagggcgaagcagctggctgccccactattggatgccaaga
tgggttgaagcaactgatccttctgctcgcacattgaaacattacaagtcagctattcaa
gagtag

DBGET integrated database retrieval system