KEGG   Gallus gallus (chicken): 420599Help
Entry
420599            CDS       T01006                                 

Gene name
HDAC9
Definition
histone deacetylase 9 (EC:3.5.1.98)
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
2
AA seq 1069 aa AA seqDB search
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMVPMVDPIMREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQELERHRR
EQQLPPLRGKERGRERAVASTEVKQKLQEFLLSKSATKDSPANGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGASPPYKYTLPGSQDAKDDFPLRKTASEPNLKVRSRLKQKVTERRSS
PLLRRKDGNVVSSFKKRLFEVTESSVSSSSPGSGPSSPSNGPTSSITESETSVLPSSIQA
EHLVSQQRLLIQDESVNLLSLYTSPSLPNITLGLPAVQSQISASSSFKEKQKGETQTLRP
GVALAGQYGGNLPPSSTHPHVALEGKPNSSHQALLQHLLLKEQMRQQKLLVTGAVPLHPQ
SPLAAKERGSPGVRAAHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQ
IHMNKMLSKSIEQLKQPGSHLEEAEEELNGDHSMQEERAPASSASIRAESSSAGEDDRIG
QQVGAVKVKEEPPDSDEDTQTQQMESGEQAAFVQQEFLAHQRVHQLQIYQAQMATVGMAG
LDKHRLVSRTSSSPTDSTLPHPAVDQPSQHVYTTGVVYDSLMLKHQCMCGNYANHPEHAG
RIQSIWSRLQETGLLNKCERIRGRKASLEEIQLVHSEHHSLLYGTSPLNRQKLDPRKLLG
NVSQKLFSLLPCGGLGVDSDTVWNELHSAGAARMAVGCVIELAARVASRELKNGFAVVRP
PGHHAEESTAMGFCFFNSIAITAKYLRDKLNIGKILIVDLDVHHGNGTQQAFYADPSILY
VSLHRYDEGNFFPGSGAPNEVGSGPGEGFNINIAWTGGLDPPMGDVEYLTAFRTVIMPAA
NEFDPEIVLVSAGFDAVEGHDPPLGGYKVTAKCFGHLTKQLLKLADGRVVLALEGGHDLT
AICDASEACINALLGNELEPLPEDIVHQIPNMNAIASLKKTTEIQSKYWKSVEPYSVPVD
CALAESQKREREETETVSAMASLSVDVEQCFPQEGSRAAGEPMEEEPAL
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggatgtgaagtcggaggttcccgtgggactagagcct
atctcaccattagacttgcgaactgatctcaggatgatggttcccatggtggacccaatt
atgcgtgaaaagcagctacagcaggagctacttctgatccagcagcagcagcaaattcag
aaacaactgctgattgcagagtttcagaaacagcatgaaaacctgacccgccagcaccag
gcccagctccaggagcacataaaggaactcctagccattaaacagcagcaagaacttctt
gaaaaagagcagaaactggagcaacagaggcaagagcaggaactggagaggcatcgcagg
gaacagcagctccctcccctcagaggcaaagaaagaggccgagaaagggcagtagccagt
acagaagtgaagcaaaaacttcaggagttcctgttaagtaaatcagcaacaaaagactct
ccagcaaatggaaagaatcattccgtgagccgccaccccaagctctggtacacggctgcc
caccatacctcactggatcaaagctctccacccctgagtggggcctcgccgccatacaaa
tacactttaccaggatcacaggatgccaaggatgatttcccactccgtaaaacggcttca
gagcccaatttgaaggtacgttcaaggttaaaacaaaaggtaacagaaaggagaagcagt
cctttacttaggaggaaggatggaaatgttgtcagctcattcaagaagcgactctttgag
gtgacagaatcctcggtgagtagcagctcccctggatcaggtcccagttccccaagcaat
ggtccgaccagcagcataacagaaagtgaaacctcggttttgccatctagcattcaagct
gagcatctggtttcccagcaacgccttttgatacaggatgaatcagtgaacttgttgagt
ctgtacacgtccccttctttgcccaacattactttgggacttccagctgtacaatctcaa
atcagtgcttcatcatcattcaaagaaaaacagaaaggagagacccagacactcagacca
ggagtggccttggctggacagtatgggggcaaccttcccccatcttcaactcatcctcat
gttgctttggagggaaaaccaaatagcagccaccaggctctcttgcaacatctgttactg
aaagaacagatgagacaacagaaacttcttgtaactggagcggttcctcttcatccccag
tctcctttggcagcaaaagaaaggggctcacctggtgtaagagctgcccacaaactgcct
cgccacaggccactgaatagaacccagtcagctcctcttcctcagagcactttggcccag
ctggtcatccaacagcaacatcaacagtttttggagaagcagaaacagtaccagcaacag
atccacatgaataagatgctctctaaatccattgagcagctaaagcagcctggcagccac
ctggaggaagctgaagaagagctgaatggagaccactcgatgcaggaggagcgagctccc
gccagcagtgccagcattagggctgagagcagcagtgctggtgaggatgacagaatagga
cagcaggtgggggctgtgaaggtcaaagaggagccaccggacagtgatgaggatactcaa
acccagcaaatggaatctggggagcaagctgcttttgtgcaacaggagttcctggcgcat
cagcgtgtccaccagttgcaaatctaccaggctcagatggctacagttggcatggcagga
ttagataaacatcggctggtgtccaggacttcatcttcccccactgattccacattacct
cacccagccgtggaccagcccagccagcatgtctacacgactggtgttgtgtatgatagc
ctgatgctgaagcaccagtgtatgtgtggcaactacgctaatcaccccgagcatgctgga
aggatccaaagcatctggtcgaggctgcaagaaactgggctgctaaacaagtgtgagcga
attcgaggtcgaaaagccagtctggaggaaatacagctggttcactctgaacatcattca
ctgctgtatggcaccagccccctgaacagacagaagctggaccccaggaaactcctagga
aacgtgtctcaaaaactcttttccttgctgccttgtgggggacttggggtggacagtgac
accgtttggaacgagctgcactcggccggggcggcacgcatggcggttggctgtgtcatc
gagctggcagcccgcgtggcctccagggagctgaagaatggttttgctgttgtaaggccc
ccaggccatcatgctgaagaatcaacagccatggggttctgcttttttaattcgattgca
attactgccaaatacttgagagacaagctaaatataggcaagatattgattgtagatctg
gatgttcaccatggcaacggtacacagcaggctttttatgctgaccccagcatcctgtat
gtttccctccatcgctatgatgaaggcaacttcttccctggcagtggagccccaaatgag
gtcggaagtggcccaggtgaaggttttaatataaatattgcttggacaggtggtttggat
cctcccatgggagatgttgaatatctcacagcattcaggactgtgatcatgccagctgcc
aatgagtttgatccagagattgtcctggtgtcagcaggattcgatgccgtggaaggccac
gaccctccactgggcggctataaagtcacagccaaatgttttggtcacctaaccaagcaa
ttgctgaagctagcggacggccgtgtcgtgctggcactggagggaggacatgaccttact
gccatctgtgatgcatctgaagcctgtataaatgcccttttaggaaatgagctggagcct
ctcccagaagatatcgtgcaccaaatccccaatatgaatgcaattgcttctttaaaaaag
accactgaaattcaaagcaagtactggaagtcagtggagccatactctgtgccagtggat
tgtgctctggctgagtctcagaaacgagagagggaggagacagaaacggtgtctgctatg
gcctccctttcagtggatgttgagcagtgctttcctcaggaaggcagcagagctgctggc
gagcccatggaagaagagccagccttgtga

DBGET integrated database retrieval system