KEGG   Gallus gallus (chicken): 420720Help
Entry
420720            CDS       T01006                                 

Gene name
GLB1
Definition
(RefSeq) galactosidase beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga00511  Other glycan degradation
gga00531  Glycosaminoglycan degradation
gga00600  Sphingolipid metabolism
gga00604  Glycosphingolipid biosynthesis - ganglio series
gga01100  Metabolic pathways
gga04142  Lysosome
Module
gga_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    420720 (GLB1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    420720 (GLB1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    420720 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    420720 (GLB1)
   00511 Other glycan degradation
    420720 (GLB1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    420720 (GLB1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     420720 (GLB1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   420720 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 420720
NCBI-ProteinID: NP_001265076
CGNC: 9074
Ensembl: ENSGALG00000040028
UniProt: Q5ZLM4
Position
2
AA seq 652 aa AA seqDB search
MLRLLLPLAGLAELLRAANIPQRTFGIDYDCNCFVKDGHPFRYISGSIHYSRVPRYYWKD
RLLKMKMAGLNAIQTYVPWNYHEPQMGVYDFSGDRDLEYFLQLASETGLLVILRAGPYIC
AEWDMGGLPAWLLEKESIVLRSSDSDYLTAVEKWMGVLLPKMKPHLYHNGGPIIMVQVEN
EYGSYFACDYDYLRSLLKIFRQHLGDEVVLFTTDGASQFHLKCGALQGLYATVDFAPGGN
VTAAFLAQRSSEPTGPLVNSEFYTGWLDHWGHRHIVVPSETIAKTLNEILARGANVNLYM
FIGGTNFAYWNGANMPYMSQPTSYDYDAPLSEAGDLTEKYFALREVIGMYNQLPEGLIPP
TTSKFAYGRVRLQKVGTVVEVLDRLSPSGPVKSTYPLTFVQLKQYFGFVLYRTKLPKNCT
EPTQLSSPFDGVHDRAYVSVDGVQQGVLERGKSLMINITGNAGANLDILVENMGRVNFGR
FNNDFKGLVSNLTLDEDILVEWEIYPLNIDGTVNHFIHGYPDQPKRSVGNPQSYEAPAFY
TGTLSIPGGIPDLPQDTYVKFPDWTKGQIWINGFNLGRYWPARGPQLTLFVPRNILVSSV
PNNITVLELEHSPCSTQLCDIEFVDTPIINATTPYENDAPPLFVRDMWLSHL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgctgctcccgctggccggcctggcggagctcctccgtgcggcgaatata
ccccagaggacttttgggattgattatgactgcaactgctttgtcaaggatgggcaccct
ttccgttacatctctggtagcattcactattcccgggtgcctcggtattactggaaggac
cgcctcttgaagatgaagatggccgggctgaatgcaattcaaacgtatgtaccgtggaac
taccatgaaccccagatgggtgtgtatgatttttctggtgacagagatctggagtatttc
ctgcagcttgctagtgaaactggcttgcttgtgatcctaagagctggaccttacatctgt
gcagaatgggacatgggtggtcttcctgcgtggctgttggagaaggaatctattgttttg
agatcttctgattcagattacctgacagcagtggagaaatggatgggggtccttttgcca
aagatgaagcctcacctctatcacaatggaggtccaatcatcatggtgcaggtggagaat
gagtatggaagctactttgcttgtgactatgactatctgcgttcccttctgaagatcttt
cgccagcatcttggggatgaggtggtgctgttcacaactgatggtgcaagccagtttcat
ttgaaatgtggagctcttcagggtctttatgcgacagtagactttgccccaggtggaaat
gtcacagcagcattcttagctcaaaggagcagtgaacctacaggccctttggttaattct
gagttttatactggatggctggatcactggggacaccgtcacattgttgtaccctcagaa
actatagctaaaacacttaatgaaatcttggcacgtggcgctaacgtaaacctgtacatg
tttataggtggaactaactttgcctattggaatggtgctaatatgccttatatgtcacaa
cccactagttatgattatgatgctccattaagcgaagcaggggatctgacggaaaaatat
tttgccttgagggaagtcattggtatgtataaccagttaccagaaggtcttatccctccg
acaacatccaaattcgcctatgggagggttcgcttgcagaaggtgggcactgtggtggag
gttcttgacaggctgtcaccttctggaccagtgaaaagcacttacccattaaccttcgtt
cagctcaagcagtattttgggtttgtactgtacagaacaaagcttccgaaaaactgcaca
gagccaacacaactgagttcacctttcgatggagtccatgatcgtgcttatgtctctgtg
gatggggttcagcaaggagtccttgaaaggggcaagtcactaatgataaatataactgga
aatgctggagcaaatctggacatcttagtagagaatatgggccgagtcaactttggaaga
ttcaataatgacttcaagggtctggtttcaaatttaactcttgatgaagatatacttgtt
gaatgggaaatctatcccctaaatatagatggaacagtgaaccatttcattcatggctac
cccgaccaaccaaagagatctgttggcaatccacagagttatgaagcacctgctttctac
actggtacactttcaattcctggagggattccagacttgcctcaagacacctatgtcaaa
tttcctgactggacaaaggggcaaatttggatcaatggctttaatcttggtcgctactgg
ccggcccgtggccctcaattgaccctttttgttccaaggaatatacttgtttcatcggtg
cctaacaacataacagtgttggagctggagcattctccatgcagcacccagctgtgtgac
atagaatttgtagacacacctattattaatgcaaccacaccgtacgaaaatgatgccccc
cccctgtttgttagagacatgtggctgagccatctataa

DBGET integrated database retrieval system