KEGG   Gallus gallus (chicken): 420744Help
Entry
420744            CDS       T01006                                 

Gene name
BMPER, CV-2
Definition
(RefSeq) BMP binding endothelial regulator
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
2
AA seq 678 aa AA seqDB search
MPRPGGSPAGTPGLVPAAAVLLGALCLPGAPASSLLTGSIAKCENEGEILQIPFITDNPC
IMCVCLNKEVTCRREKCPLLSKECALVIKQRGACCERCKDCTFGGKTYNSSMRWHLPSNP
CITYQCQEGVIIESEVQCVVHCKNPSKVVGMCCPVCPGCIFEGRHYNEGEEFRPEGNKCT
KCSCVGGRTQCIQEVCPILSCPQHLSHIPAGQCCPKCLGQRKVFDLPFGSCLFHSNVYDN
GSSFIYDNCTVCTCKDSTVICRKRCLLPGECNKNQDHCCKECVSYITPEEMKVCKFGNKI
FQDGEMWSSVNCTICACVKGKTECRKKQCIPVNSCPHGKILNRKGCCPICTEKPGVCTVF
GDPHYNTFDGRTFNFQGTCQYVLTKDCSSSASPFQVLVKNDARRTRSFSWTKSVDLVLGR
STISLQQHLTVKWNGTRISLPCETPQFQIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAP
HLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCSRPQRKPVPELCH
GTVRVKLRAHRECQKLKAWDFQSCHSTVDYTTFYRSCVTDMCECPVHKNCYCESFLAYAR
ACQREGLRVQWIPEQHCAATQCKHGAVYDTCGPGCVKTCDNWNEIGPCNKPCVAGCHCPA
NLVLHKGRCIKPVLCPQR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgccccggcccggcgggagcccggcggggacacccggcctcgtcccggccgctgccgtc
ctcctgggcgccctctgcctccccggggcgccggcctcctccctgctcacaggatccatt
gcaaaatgtgaaaacgaaggggaaattctacagataccatttatcacagacaacccttgt
ataatgtgtgtttgcctgaataaggaagtgacctgcagaagagagaagtgtcccctgctt
tctaaggaatgtgctcttgtcattaagcagagaggagcttgctgtgaacgttgcaaagac
tgcacttttggaggaaagacatacaacagctctatgagatggcacctccctagcaatccc
tgtattacataccagtgccaggagggagtgataatagagtcggaggtacagtgtgttgtt
cattgcaaaaacccatccaaagttgtggggatgtgttgccctgtgtgtccaggttgtata
tttgaagggagacattacaatgaaggagaagaatttaggcctgaaggaaataaatgcacc
aagtgctcttgtgttggtggcaggacccagtgcatccaagaagtctgccccattctctcg
tgtccccagcacctcagtcacattcctgcaggacagtgttgccccaaatgcttaggacag
aggaaagtgtttgacctcccatttggaagctgtctctttcatagcaatgtgtatgataat
ggatcctcatttatttatgacaactgtacagtgtgtacatgcaaggattcaacagtgata
tgtaggaagcggtgcttgcttcctggagagtgcaataaaaaccaagaccactgctgcaag
gaatgtgtctcctacatcactcctgaagaaatgaaagtgtgcaagtttggcaataagata
ttccaggatggagagatgtggtcctctgtgaactgcaccatctgtgcttgtgtgaaaggc
aagacagagtgtcgcaagaagcaatgcattccagtcaacagctgtcctcatggtaaaatc
ctgaacagaaaaggatgctgtcctatttgcactgaaaagcctggagtttgcactgtgttt
ggagacccccactacaacacttttgatggacggacatttaactttcagggaacatgtcag
tacgttttgacgaaagactgctcctcctctgcctcgcccttccaggtgctggtgaaaaac
gatgcccgtcggacccgttctttctcctggacaaagtcagtggaccttgtgttgggcaga
agcaccatcagcctccagcagcacctcacagtgaagtggaatgggacccgtatctcacta
ccctgcgagacaccacaatttcagatcgatttggatggttatttgctgaaagtgaccacc
aaagcaggcctggaaatctcatgggacggagacagttttgtggaagtcatggctgcacca
catctgaagggcaaactctgtggcctgtgtggtaactacaatgggcacaagcgagatgac
ctgattgggggggatgggaattttaagtttgacgtggacgactttgctgaatcctggcgt
gtggagtctaatgagttctgcagtcgcccgcagaggaagcctgtgcctgagctctgccat
gggactgtcagggtgaaactccgggctcaccgggaatgccagaagctcaaagcctgggat
tttcagagctgtcattcaacggtggattacacaactttttaccggtcatgtgtgacagac
atgtgtgagtgcccagtccataagaactgctactgcgagtcattcctggcctatgctcga
gcctgccagcgggaagggctgagagtgcagtggatacctgagcagcactgtgcagcaacc
cagtgtaaacacggtgcagtttatgacacctgtggtccgggatgcgtcaaaacatgcgat
aactggaatgagattggcccatgcaacaagccctgcgttgcaggatgccactgtccagca
aatttagttcttcacaaaggaagatgcatcaagccagtcctatgtcctcagcgatga

DBGET integrated database retrieval system