KEGG   Gallus gallus (chicken): 420785Help
Entry
420785            CDS       T01006                                 

Gene name
PDIA4
Definition
protein disulfide isomerase family A, member 4 (EC:5.3.4.1)
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gga04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
2
AA seq 627 aa AA seqDB search
MAQLAVLVAQEDGRESVTQEVDGDDDEEEEDDDDDDNSEVKEENDVLVLNDANFDTFTAD
KDTVLLEFYAPWCGHCKQFAPEYEKIAKTLKENDPPIPVAKIDATAATALASRFDVSGYP
TIKILKKGQPVDYDGSRTEDAIVAKVKEISDPNWTPPPEATLVLTQDNFDDVVKDADIIL
VEFYAPWCGHCKRLAPEYEKAAQELSKRTPPIPLAKVDATAETELAKKFDVTGYPTLKIF
RKGKPYDYSGPREKYGIVDYMIEQAGPPSKQIQATKQVQEFLKDGDDVIIIGVFSGETDE
VYQLYQEAANSLREDYKFHHTFSSEIAKLLKVSPGKLVVMQPEKFQSKHEPKMYVLDLKY
STSESEIKEHVVKHALPLVGHRKPSNDAKRYAKRPLVVVYYTVDFSFDYRVATQYWRGKV
LEVAKDFPEYVFAVSDEEDYSSEIKDLGLLESGEDVNVAILDEGGKKYAMEPEEFDSDAL
RQFVLAFKKGKLKPIVKSQPVPKNNKGPVKVVVGKTFDTIVMDPKNDVLIEFYAPWCGHC
KKLEPVYTELGKKYKNEKNLVIAKMDATANDVTNDHYKVEGFPTIYFAPRDKKNNPIKFE
GGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctggccgtgctggtggcgcaggaggacggcagagaatctgttacacaagaa
gttgatggtgatgatgatgaagaagaagaagatgatgatgatgatgataactctgaagtt
aaagaagaaaatgatgtgttagtcttgaatgatgcaaactttgacacctttaccgcagac
aaggacactgtgctcctggagttctatgcaccatggtgtgggcattgcaagcagtttgct
cctgagtatgaaaagatagctaaaaccctgaaggaaaatgaccctcctattccagttgcc
aaaattgatgctactgcagccactgcactagcaagtcgttttgatgtcagtggttaccca
accattaaaatcctgaaaaaaggccagcctgttgactatgatggttctcgaacagaagat
gcaattgtggccaaagtcaaggagatttctgaccccaattggacccctccaccagaagct
actctggtattgacccaggataattttgatgatgtcgtgaaagatgctgacataattcta
gtggaattctatgctccatggtgtggacactgcaaaaggcttgctccagaatatgagaag
gccgcccaggagctcagcaagcgcacacctcccattcctctggctaaagttgatgccact
gctgaaactgagcttgcaaagaagtttgatgttactggctatccaactctgaaaatcttt
cgcaaaggcaaaccttatgactacagtggtccacgagagaaatacggtattgtcgactac
atgattgaacaggctggtcctccatctaaacagattcaggctacgaagcaggtacaggaa
tttctgaaggatggagatgatgtcattatcattggtgtttttagtggagaaactgatgaa
gtctatcagctctaccaggaagcagctaacagtttaagagaagattacaagttccatcac
accttcagcagcgagattgcaaaactattgaaagtatctcctggaaaattggttgtcatg
cagccggaaaagtttcaatcaaagcatgagcccaagatgtacgttttggatcttaaatat
tctacaagtgagtcagagatcaaagagcatgtagtgaaacatgctttgcctctagttggt
catcgcaagccttccaatgatgctaaaagatatgctaagcgtcctctagtggttgtctat
tatactgttgactttagttttgactatcgtgttgctacccagtactggagaggcaaagtc
ctagaagtagccaaggacttccctgaatatgtgtttgctgtttctgacgaggaagattat
tcttctgaaataaaggatctaggtctgcttgagagtggagaggatgtaaatgttgccatt
ctggatgaaggtggcaagaaatatgccatggagccagaagagtttgactctgatgccctc
aggcagtttgtgctggcattcaaaaaaggaaaactgaagcctattgtgaagtcacagcca
gtgccaaaaaataacaaagggcctgtgaaagtggtagtgggtaaaacttttgataccata
gtaatggatccaaagaatgatgttctcatagagttctatgccccatggtgtggacactgc
aagaaactagaaccagtgtatactgagctaggcaaaaaatacaagaatgagaaaaatcta
gtcatagccaagatggatgctactgccaacgatgtgacaaatgatcactacaaagtggaa
ggattccctaccatctactttgctccaagggacaagaagaacaatcctattaaatttgaa
ggtggtgacagagatttagagcatttgagtaaatttatagaggagcatgcaacaaaactc
tctagaacaaaagaagagctttag

DBGET integrated database retrieval system