KEGG   Gallus gallus (chicken): 421027Help
Entry
421027            CDS       T01006                                 

Gene name
TMX3, TXNDC10
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     421027 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 562 aa AA seqDB search
MRSEGRSARRRAVSPSGRARSPVNMAAMGGRQQCLWAAGNGRAGCVRCRDRERAAGPGAG
EGPRGGGQCRGVRRQWRAVRARGAAAGVEGRRGLGEGPGSCEGLRAGTPSPAGVTHGSSH
PAVVALALASEAAFVEDLDESFKENRKDDIWLVDFYAPWCGHCKKLEPVWNEVGMEMKNM
GSPVKVGKMDATSFSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFANRVAGPL
IRPLPSQHMFEHVRKRHRVLFVYVGGESPLKEKYIEVASELIVYTYFFSASEDVLPEYLT
LPELPAVVVFKDGTYFVYDEYEDGDLSSWINRERFQGYLTVDGFTLYELGDTGKLVAIAV
IDDKNSSVEHTRLKSIIQEVARDYRDHFHRDFQFGHMDGNDYINSLLMDDLTIPTIVVLN
TSNQQYFLPDRHIENTEDMVQFINNILDGTAEAQGGDGVLQRIKRIVYDAKSTVVSVFKS
SPLLGCFLFGLPLGVISIMCYGICTADTDGGVDEHEAVKKENSDRELTDDGSEEEQEEEN
GKYTELSDGELKQKDLLEKKKD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtgagggaaggtcggcgcggcgccgtgccgtttccccttccggccgtgcccgg
tctcctgtcaacatggcagcgatgggtgggcggcagcagtgtctgtgggcggcaggtaac
ggccgtgcgggatgcgtgcggtgcagggaccgggagagagcggcgggccctggggcggga
gaagggccgaggggcggcgggcagtgccgcggcgtgcggaggcagtggcgggcggtgcgg
gcacggggagccgcggccggggtggaggggaggcgagggctgggagagggccccggatcg
tgcgaaggactccgagcgggcacccccagcccggccggggtcactcacggttcttctcac
ccagcagtggttgcgctggcgttggcatcagaagcagcttttgtggaggatctggatgaa
tcgtttaaagaaaaccgtaaagatgatatttggcttgtagatttttatgcaccgtggtgc
ggccactgcaaaaaattagaacctgtgtggaatgaagtgggtatggaaatgaaaaacatg
ggctctccagtaaaagttgggaagatggatgcaacttccttctctagtattgcatctgaa
ttcggagtgcgaggctatccaacaattaagctcttaaaaggtgacttagcatacaactat
agaggacctaggaccaaagatgatataattgaatttgctaatagagtagcaggacctctt
atcaggccacttcctagccagcatatgtttgagcatgtgcgaaagaggcatcgtgtactt
tttgtatatgttggtggggaatctcctttaaaggaaaaatacattgaagttgcttcagaa
ctaattgtttatacatactttttttctgcctcagaagatgtgctacctgagtatctgacc
ttgcctgaactacctgctgttgttgtattcaaagacggaacttactttgtgtatgatgag
tatgaagatggtgatttgtcatcctggataaatcgagaaagatttcaaggttatcttact
gtggatggttttacgttgtacgaacttggagatacaggaaagcttgtggctattgcagtc
attgatgacaaaaactcttcagtggaacataccagactgaaatctattattcaggaagtt
gcaagagattatcgggatcactttcacagggatttccagtttggccatatggatggaaat
gattatatcaatagcttactaatggatgacttgacaattcctactattgttgttttgaat
acctccaatcagcagtattttctaccagataggcacatcgagaacacagaagacatggtt
cagtttattaacaatatcttggatggtacagctgaagcacaaggtggtgacggagttctg
cagcgaatcaagagaatagtctatgatgccaagtctactgtagtgtcagtattcaagagt
tcaccacttctgggatgctttctctttgggttgcccctgggtgtcatcagcataatgtgt
tacggaatctgcacagctgatacagatggaggtgtagatgaacacgaggcagttaaaaag
gaaaacagcgatcgggagctcacagatgatggcagtgaggaagagcaagaggaggagaac
ggaaaatatacagaactttcagatggagagcttaaacagaaagacctattggaaaagaaa
aaagactaa

DBGET integrated database retrieval system