KEGG   Gallus gallus (chicken): 421132Help
Entry
421132            CDS       T01006                                 

Gene name
IMPAD1
Definition
(RefSeq) inositol monophosphatase domain containing 1
  KO
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    421132 (IMPAD1)
  Energy metabolism
   00920 Sulfur metabolism
    421132 (IMPAD1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    421132 (IMPAD1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     421132 (IMPAD1)
    3.1.3.25  inositol-phosphate phosphatase
     421132 (IMPAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 356 aa AA seqDB search
MAPMGIRLSPLGMAVFCLLGLGVLYHLYSGFLAGRFAFFMLSEPAAGGPEGPRGSAASVD
LRELLAVSVLAAVRGGKEVRRVREGNVLNEKAKGKTREGXEEKLTSGDLLSNRRMFHLLR
AAFPTVQINSEERVDAADQETVSWDRSIPEDIKEKIQPKEVPAESVTVWIDPLDATQEYT
EDLRQYVTTMVCVAVNGKPVIGVIHKPFSEYTAWAMVDGGSNVKARSLYNEKTPRIIVSR
SHAGKVEQVARQTFGNKTVIIPAGGAGYKVLALLDVADKNQEEADVYIHVTYIKKWDICA
GNAVLRALGGHMTTLTGEEISYTGSDGNEGGLIASINMDHKALIEKLPDLEKTSHK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctatggggatccgcctctcgccgctcggcatggccgtgttctgcctgctgggg
ctgggcgtcctctaccacctctactccggcttcctggccggccgcttcgccttcttcatg
ctgagcgagccggcggcgggcgggcccgagggaccccgcggttcggcggcctccgtggac
ctgcgggagctgctggccgtgtccgtgctggcggccgtgcggggcggcaaggaggtgcgg
cgggtccgcgagggcaacgtgctcaacgagaaggccaaggggaagacgcgggaggggncc
gaggagaagctgacgagcggcgacctgctgtccaaccgccgcatgttccacctgctgagg
gccgccttccccaccgtgcagataaactctgaggaacgtgttgatgcagctgatcaggag
acagtctcttgggatcgcagtattcctgaagacataaaagaaaaaatacagcctaaagag
gttccagcagaaagtgttactgtctggattgatccattagatgctacacaagagtacaca
gaggatcttcggcagtatgtcacaacaatggtttgtgtggctgtaaatgggaaaccggta
ataggagtgatacataagccattctcagaatatacagcctgggcaatggtggatggtggg
tcaaacgtaaaagctcgttccttatacaatgagaaaactccaaggattattgtatcccgc
tcccatgcaggaaaagtggagcaggttgcacggcagacctttggaaataagactgtgata
atccccgctggtggagcaggttacaaagtgctggctctccttgacgtggctgacaagaat
caagaagaagctgatgtgtatatccatgtcacctatattaagaagtgggacatatgtgct
ggaaatgcggtgctgagagcattgggtggccatatgactactctgacgggcgaagaaatt
agttacactggctcagatggcaatgagggaggacttatagccagtatcaatatggaccat
aaagcactgattgaaaaacttccagatctggaaaaaacatcacacaaataa

DBGET integrated database retrieval system