KEGG   Gallus gallus (chicken): 421193Help
Entry
421193            CDS       T01006                                 

Gene name
USP34
Definition
ubiquitin specific peptidase 34 (EC:3.4.19.12)
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     421193 (USP34)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   421193 (USP34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
3
AA seq 3549 aa AA seqDB search
MCESCAELLEVLNEISDVEGADGLQLRKEHVLKIFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCTLINLVIAEVQALRDQLCKHCTINIDSTWQDHSNRADEPLNVERDSHEEENGERQR
SIEKKIDSARTCILTEESSAKNTDAFSWSTDEKEKLLLCVAKIFQIQFPLYTAYKHNTHP
TIEDISAQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFLI
AHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQTAARNMADLMWSTVK
EPLDTALCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSI
AKELADWLISNNVIEHIFGPNIHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKHC
SRYIHDLFPSLIKNLDPVPLRHLLNLVSTLHPSAHTEQTLYLASMLIKALWNNALAAKAQ
LSKQSSFASLLSTNLPIGNKKEEDLRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMEEQ
LINRTKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEANSSHASQSA
ESPGSEVQSEDIADIEALKEEEDEEEEDRNHNPQKNSRSTDIRSRKLESQTDICLGDSQG
VSERSSTNNGTGKDHVFNTDSVTPVDNRIRILDACSHAEDADHDMTGEMSTAHISQGSQD
SCITHTGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHDGHMVDDMLSADDVSCSSSQ
VSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKH
QYNSSAVTDINLDNVCKKGNTLLWDLVQDEDAIHLSEGLINEAEKLLCSLVCWFTDRQIR
MRFIEGCLENLANNRSVVVSLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDN
LVHYIQTVREGRHKYALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVE
DSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLA
RLATSTYDGGSNSELCGMDQFWGIALRAHTGDVSRAAIQYINSYYINGKTGLEKEQEFIS
KCMESLMIASSNLEQDSHSSLTIIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHL
KALSDKQSLPLRIVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQINQQAQLQ
EFGQSSRKGDFPGGLMGPVRMISSGHELTTDYDEKTLHELGFKDMQMVFVSLGAPRRERK
GDGVQLPASCLPPPQKDNIPMLLLLQDPHLTTLFDLLEMLASFKPPSGEVSMEDTESAKC
EELHLHAENLSRRVWELLMLLPTCPNMLQAFQNISDEQGNDGFSWKDLLRIKSAHKLLYA
LEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQIENSKNTWSCKFVAAGGLQQLLEI
FNSGILEPKERESWTVWQLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGVAESHRKRT
WPGKSRKTASDHVKGLHIPRLTEVFLVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHR
SRHEVTHYSMWLLVSWAHCCSSVKSSLADSDYLQDWLKKLTLLIPETAVRHESCNGLYKL
SLSGLDGGDSINRSFLLLAASTLLKFLPDAQVLKPIQIEDYEEEPVLRPGCKEYFWLLCK
LIDNIHVKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVIKH
KPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYR
LLHNWVMAQHMQSSHAPYKWDYWPHDDVRAECRFVGLTNLGATCYLASTIQQLYMIPEAR
QAIFTAKYSEDMKHKTTLLELQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDM
TEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMK
NIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMM
KEKVNTHFSFPLRLDMTPYTEDFLMGKNDRKEGFKEDGEYLKETESYEYDLIGVTVHTGT
ADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSTQLASECFGGEMTTKTYDSVTDK
FMDFSFEKTHSAYMLFYKRMEPEEENGKDYKFDVSSELLEWIWHDNMQFLQDKNIFEHTY
FGFMWHLCSSIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNS
QAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMED
CSDDMDGPVEDIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQF
LLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIA
LIALLVEQSRSERHLTLSQNDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNR
LAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNP
SQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQ
MFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFM
TYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCVDCPENVRLI
VQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQ
WAFKNLTPHASQYPGAVEELFNLMQLFVAQRPDMREEETEDIKQFKKTTISCYLRCLDGR
SCWTTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLS
IFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVL
LSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENLKLIGGKSNIRPPRPELNMCL
LPTMVEASKGKDDVYDRMLLDYFFSYHQFIHLLCRVAISCEKFTETLVKMSVLVAYEGLP
LHLALFPKLWTELCQTQSAMSKNSVKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFLTH
FLLKVQGQVFSEANCANLINTLIANLINQYQSLESDFSSQRVEISKASSALNGDLRALAL
LLSVHTPKQLNSALIPTLQELLNKCRACQQQRNSLQEQEAKERKIKDDEEATPVKRRRVS
SDEEHTVDSCISDIKTEPQGALTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRME
VPSSFSEDIMLTMRPQHTEEQSGNGKFQECKEFKDLQTSKDSIVTEEDSEFPSTSISAVL
SDLADLRGCDSQALSSQDPETSLSITCGHSRGLFSLMQQHDILDILCRTIESTIHVVTRI
SGKGNQAAS
NT seq 10650 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagagctgcgccgagctgctggaggtgttaaacgagatatctgatgttgaaggt
gctgatggattgcagctcagaaaggaacatgtgctcaagatatttgcttatatcaattcc
tggacacaaaggcaatgtctgtgctgtttcaaggagtataaacatttggagatctttaac
caagtagtatgtacgcttattaacttagtgattgctgaagttcaagctctgcgggaccag
ctctgtaaacactgcactattaatatagattcaacatggcaagatcatagtaatcgtgct
gatgagcccctgaatgtagaaagagactctcatgaggaagaaaatggggagcggcaaaga
tctatagagaaaaaaatagattctgcaagaacttgtatcctgactgaggagtcatcagca
aagaacactgatgcttttagctggagcactgatgagaaggagaagttgttgctgtgtgtg
gcaaaaatctttcagattcagtttcctttgtacactgcttataagcataatactcatcct
acaatagaggatatttctgctcaagaaagcaatatactaggagcgttctgtgacatgaat
gatgtagaagtaccactgcacttgcttcgttatgtttgtctgttttgtggaaaaaatggc
ctttccctcatgaaggattgttttgagtatggaacccctgagacactgccatttcttata
gcacatgcgtttatcacagtggtgtctaatatcagaatatggctgcacatccctgctgtc
atgcagcacattataccctttaggacttacgttatcaggtatttatgtaaactatcagac
caggagttacgacagactgcagcccggaacatggcagatctaatgtggagcacagttaaa
gaacctctggatactgctttgtgctttgataaagaaagtcttgatcttgcatttaaatac
tttatgtctccaactctaacaatgagattggctgggctcagtcaaataacaaatcaactt
cataccttcaatgatgtctgtaataatgagtcattagtttcagacacagaaacgtcaatt
gcaaaagagcttgcagactggcttatcagcaacaatgtaattgaacacatttttggacca
aacatacacattgagatcatcaaacagtgccaagtgattctgaattttcttgcagccgaa
gggagacttagtactcaacatatagactgtatttgggctgcagcacagctaaagcattgc
agtcgttacatacacgatttgtttccttctttgatcaaaaacttggaccctgtcccactt
aggcatcttcttaacctagtctcgactcttcatccaagcgctcacactgagcagacattg
tatttggcatcaatgcttataaaagcactgtggaacaatgcactagcagctaaagctcag
ctgtcaaaacaaagctcttttgcatctttactcagtactaatctacctataggaaacaaa
aaagaagaggatctcagaagagcagccccttcaccttggtcgccagcagcaagccctcag
agtagtgacaacagtgacacccatcagagtggaggcagtgatattgaaatggaggagcag
cttattaacagaacaaaacatgtacaacagcgactttcagatacagaggaatccatgcaa
ggaagctctgatgagacagcaaacagtggtgaggatggcagtagtggtcctggtagtagc
agtggccacagtgatggatccagtaatgaggccaactccagtcatgcaagccagtctgct
gaaagtcctggcagcgaagtgcagtctgaagacattgcagatattgaagctctcaaagag
gaggaggatgaagaggaagaagataggaatcataatccccagaaaaacagtaggagcaca
gatatacgaagcaggaaactggaatcacaaacagacatttgtctgggagattcacaaggg
gtatcggagaggagcagtacaaataatgggacgggaaaggaccatgtttttaacactgac
tctgtaacgcccgtggataatcgaattagaatactggatgcctgttcccatgctgaggat
gcagaccatgacatgacaggggaaatgagcactgctcacatttcacaagggtctcaagat
tcttgtataacacatacaggagacttccttggggaaactattggaaatgaattatttaac
tgtcgacagttcattggtccccagcatcaccaccatcatcaccatcaccatcatcatcat
gatgggcatatggttgatgatatgctcagtgcagatgatgtcagttgcagtagttctcaa
gtcagtgcaaaatcagagaaaaatatggctgactttgatggggaagagtctggctgtgaa
gaagagcttgtacagattaattcacatgcagagctaacatctcatcttcagcagcatctt
cccaacttggcctctatctatcatgaacatcttagtcaaggaccagcagttcataaacat
caatataatagcagtgcagtgacggacattaatttggataatgtttgtaagaaaggaaat
acccttttgtgggatctggtccaggatgaagatgcaattcatctttctgaagggttaata
aatgaagcagagaagctgctctgttctttagtatgctggttcactgacagacagattcga
atgagatttattgaaggctgcttagaaaatttagcaaacaacagatcagtagtagtttca
cttcgtcttcttccaaagttatttggtacatttcagcaatttgggagcagttatgataca
cattggataacaatgtgggcagaaaaggaacttaacatgatgaaacttttctttgataat
ttggtacactacatccagacagtcagggagggacgacataaatatgcattatatagccac
agtgcagaagttcaagttcgtcttcagttcttgacttgtgttttttcaactctaggatca
ccagatcatttcagattgagtttagaacaagtggacatattgtggcactgcttagtagaa
gattctgaatgttatgatgatgcactacactggttcttgaatcaagtacgaagtaaagat
cagcatgctatgggtatggaaacttacaaacatcttttcttggaaaagatgccacaacta
aaacctgaaactatcagtatgactggactaaatctcttccagcatttgtgcaatttggct
cgattggctactagtacatatgatggtggctcaaactcagagttgtgtggcatggaccag
ttctggggtattgctctaagagcacacactggtgatgtcagtcgagcagctatccagtat
atcaactcctattatatcaatggtaaaactggtcttgaaaaagaacaggagtttattagt
aagtgtatggaaagtctgatgatagcttctagtaatcttgaacaagactctcattcaagt
ctgacaattattgaaagaggactcttaatgctaaagacacatctggaagcttttaggaga
aggtttgcatatcatctgaggcagtggcagattgaaggtactggtatcagcagtcatttg
aaagccctgagtgacaaacagtcactaccattaagaattgtatgccagccagctggactt
cctgacaagatgactatagaaatgtatcctagtgatcaagtggcagatctacgagctgaa
gtcacccactggtacgaaaatttgcagaaagagcagataaatcaacaagcacagcttcag
gagtttggccaaagcagccgaaaaggggattttcctggtggcctcatgggacctgtgaga
atgatttcatctgggcatgaactgacaactgattatgatgaaaaaactcttcatgaattg
ggttttaaggatatgcagatggtatttgtatccctgggagcaccaaggagagaacgtaaa
ggtgatggtgttcaacttccagcatcttgcctacctcctcctcaaaaggacaacattcca
atgctattactcttgcaagatcctcatcttactaccctttttgatctgctagagatgcta
gcctcctttaaacctccttctggagaagtgtctatggaagatactgagagtgcaaaatgt
gaagaactccatcttcacgcagaaaacttatccagacgtgtttgggaactgttaatgctt
ctaccaacatgccctaatatgttgcaggcattccagaatatttcagatgaacaggggaat
gatggctttagctggaaggatcttttgcgaataaaaagtgcccataaacttctgtatgcc
ttggaaattattgaagctctgggaaagcccaacagaagaataagacgtgaatctacggga
agctatagtgatctttatccagactcagatgattcaagtgaagatcaaatagaaaatagt
aaaaacacatggagctgcaagtttgttgctgctggaggactccaacaattactagaaatt
tttaattctggaatcttagaacctaaagaacgagagtcgtggactgtgtggcagttggac
tgccttgcttgcttgctgaagctgatatgccagtttgcagttgatccttcagatctggat
ttagcttaccatgatgtctttgcctggtctggtgtagcagagagtcacagaaaaagaacg
tggcctggcaaatcaaggaagactgcaagtgaccatgtgaagggccttcacatacctcgc
ttaacagaggtgtttcttgtacttgtccagggaaccagtctgattcagcgacttatgtca
gttgcttatacgtatgacaacttggctcccagggtgttgaaagctcagtctgatcacaga
tcaagacatgaagtcacacattattcaatgtggctcttggtgagttgggctcactgctgt
tcctcagtgaaatcgagtttggcagacagtgattatttacaagactggctaaagaaactt
acccttcttattccagagactgctgttcgtcatgagtcatgcaatggtttatacaagtta
tctctttctggtctcgatggaggagactcaattaatcggtcctttttgctgctggctgca
tcaacgttattaaaatttcttcctgatgctcaagtcctcaagcctattcaaattgaggat
tatgaagaagaaccagtgctacgaccaggttgtaaggaatatttttggctgctgtgcaaa
ctgatcgataacatacatgtcaaagatgcaagtcagaccacgctgcttgatctagatgca
ttggcaagacatcttgctgactgcattcggagcagagaaatccttgaccatcaagatggc
aatatagaagatgatggacttacaggactgcttcgtcttgctacaagtgttattaagcac
aagccaccctttaaattttctcgtgaaggacaggagtttctgagagacatcttcaatctt
ttgttcttgctgccaagtttaaaagatagacaacagccaaaatgcaagtcacattcttca
agggctgctgcgtatgacttgttagtagaaatggtaaagggatctgttgaaaactacagg
ctactccacaactgggttatggcgcaacatatgcagtcttcccatgcaccttacaagtgg
gattattggccacatgatgatgttcgagcagaatgtcgatttgtgggtctgactaatctt
ggagcaacctgttacttggcatcaactattcagcaactgtatatgataccagaagccaga
caagcgatctttactgcaaagtattcagaagatatgaaacacaagaccactctactagaa
ctccagaaaatgtttacatacttaatggaaagtgaatgtaaagcatataatccaaggccc
ttttgtaaaacttataccatggataagcagccgctgaacactggagagcagaaagatatg
actgagttcttcactgacctgatcacaaaaatagaagagatgtctcctgaactgaaaaac
acagtgaaaagtttgtttggaggtgttattacaaacaatgttgtttccttggattgtgaa
catgtaagtcagactgctgaagagttctatacagtaagatgccaggtagcagatatgaag
aatatttacgaatctcttgatgaagtaactattaaagataccttggaaggtgataacatg
tatacatgttctcattgtgggaaaaaagtgcgggctgaaaaaagggcatgttttaagaaa
ctacctcgtatcttaagcttcaacactatgagatatacatttaatatggtaactatgatg
aaggagaaagtgaacactcatttttcattccctctgcgtttggatatgacaccttatact
gaagatttcctcatgggaaaaaatgacagaaaagaaggttttaaggaagatggcgaatat
ttgaaagaaactgagagttatgagtatgatctaataggcgtaacagttcatacaggaaca
gcagatggtggacattattacagtttcatcagagatatagtaaatccccatgcttacaaa
aacaacaaatggtatcttttcaacgatgctgaagtaaaaccatttgattcaacgcagctt
gcttcagaatgttttggtggagaaatgacaacaaaaacatatgattctgttactgataaa
tttatggacttctcctttgaaaagacacacagtgcttacatgctgttttacaaacggatg
gagccggaggaggaaaatggcaaagactacaaatttgatgtttcttctgagttgctggag
tggatatggcatgataacatgcagtttcttcaagacaagaacatttttgaacatacgtat
tttgggtttatgtggcatttgtgtagtagcatcccaagcacactaccagatccaaaagca
gtttccctgatgacagcaaagttaagcacttcttttgtactagagacatttattcattca
aaggaaaagcctacaatgcttcagtggattgaacttttaacaaagcagtttaataacagt
caggcagcttgtgaatggtttttggatcgtatggcagatgatgattggtggccaatgcag
attctaataaagtgtcccaatcagattgtgagacagatgttccagcgtttgtgcattcat
gtgatacagagactgagaccagtgcatgcacatctttatcttcagccagggatggaagac
tgttcagatgacatggatggtcccgtggaagacattggcagtcgctcttgtgtaacacgt
tttgtgaagactctcttgtctattatggagcatggtgttaagccacacagtaaacatctc
acagaatactttgcctttctttatgaatttgccaaaatgggtgaagaggaaagccaattc
ttgctttcactgcaagccatatcaacgatggttcatttctacatgggaactaaaggacct
gaaaatccgcaggttgaagtactttctgaggaagaaggggaggaagaggaggaggaggaa
gatatactttctttagcagaagaaaaatataggcctgctgctcttgagaagatgattgcc
ctgattgctctcctagttgaacagtctcgctcagaaaggcatttgactttatcacagaat
gacatggcagcattaacaggaggaaagggttttccttttttgtttcaacatatccgtgat
ggtatcaacatcaggcaaacttgcaatctcatcttcagtttgtgtcggtacaataataga
cttgcagaacatattgtgtccatgcttttcacatctatagcaaagttgactcctgaggca
gccaatccttttttcaaactattgactatgctaatggaatttgctggtggacccccagga
atgccaccttttgcttcttacattctgcagaggatttgggaggtcattgaatacaacccg
tctcagtgcctggattggctggctgtgcaaacgcctcgaaataagctagctcacagctgg
gtgctacaaaacatggaaaactgggttgaacgttttcttttggcacataactatcctaga
gtgagaacttctgcagcctatctcttggtgtcacttattccaagcaactccttccgtcag
atgttccgatcaacccgctctttgcacatccctacacgtgatctgcctcttagtccagat
actacagtagttcttcatcaagtctacaatgtgcttcttggccttctttcaagagctaag
ttatatgttgatgctgctgttcatggcacaacgaaactcgtgccctacttcagtttcatg
acatactgtttgatctcaaaaactgagaaactcatgttttctacttacttcatggactta
tggaaccttttccagcctaaactttctgagccagctatagccaccaaccacaataaacag
gctttgttgtctttttggtataacgtctgtgttgactgtccagagaatgtgcgccttatt
gtacagaaccctgtggtgacaaagaacattgccttcaattacatccttgcagaccatgat
gatcaggatgtagtgctcttcaaccgtgggatgctgcctgcctactatggcatcctgcgt
ctctgctgtgagcagtcccctgcgttcacgaggcagttggcttctcaccagaacatccag
tgggccttcaagaatctcacaccgcatgctagtcagtacccaggagcagtagaagaactg
tttaacctcatgcaactttttgtagctcagagaccagacatgagagaggaagagacagaa
gacataaagcagtttaagaaaaccaccataagctgttatctgcgctgcttggatggacga
tcttgttggactactttaataagtgccttcagaatattattggagtctgatgaagacagg
cttcttgttgtgtttaacagaggattgattctgatgactgagtcatttaacacattacat
atgatgtaccatgaggctacagcttgccacgtgactggagacctggtagaacttctgtct
atattcctttcagttcttaaatcgacacgtccatatcttcaaagaaaagatgtgaagcaa
gctctcattcagtggcaggagcgaattgaatttgcccataagcttttaactttgctaaat
tcctacagtcctccagaacttagaaatgcttgtattgatgtcctcaaggagcttgtactt
ttaagtcctcatgatttcctacatactctggttccatttctacagcacaatcattgtaca
taccaccacagtaatatcccaatgtctcttggaccttattttccatgtcgtgaaaacttg
aaattaatagggggaaaaagcaatattcgtcctccacgtcctgagctcaatatgtgcctc
ttgcctactatggtagaagccagcaagggtaaagatgatgtttatgatcgtatgctgcta
gactacttcttttcttatcatcagttcatccatctactctgccgagttgcaatcagctgt
gagaagtttactgaaacattagttaaaatgagtgttcttgttgcatatgaaggtttgcca
cttcatcttgcgttattccccaaactttggactgagctttgtcagactcagtctgcaatg
tcaaagaacagtgtaaagctcctctgtgaagatccggtttttgcagaatatataaaatgt
attctaatggatgaaaggacctttcttaacaacaacattgtatacacctttttgacgcat
tttcttctgaaggtccaagggcaggtgttttctgaagcaaactgtgccaatttaatcaat
actctaattgcaaatctaataaatcagtatcaaagcctagaatctgatttcagcagccag
agagttgaaatctccaaagcaagctctgctttaaatggggacctccgagcacttgccttg
ctgctttcagtgcatactcctaaacagctcaattcagccctgattccaactttacaagaa
cttttaaacaagtgtagagcatgtcaacaacagaggaattcattacaagaacaagaagcc
aaagaaagaaaaattaaagatgacgaagaagctactcctgtaaaaagaagacgggtcagc
agtgatgaggagcacactgtagacagttgtatcagtgatataaaaactgaaccccagggg
gcattgaccccaacaagcacttcagataatgagacacgggactcttcaatcattgatcca
ggcactgaacaagatcttccttcccctgaaaacagttctgtcaaagagtacagaatggaa
gttccatcttcattttcagaagacataatgctgacaatgaggccacagcatacagaagag
cagtcaggaaatggtaaatttcaagaatgcaaagaatttaaagacctgcagacatccaag
gattccattgtaacagaggaggactcagagtttccttccacatcaatttcagcagtttta
tctgacctcgcagatttgagaggctgtgatagtcaagccttatcatcccaggaccctgaa
actagtttatcaatcacttgtggccattccagaggactttttagtcttatgcagcagcat
gacattttagacatcctgtgtaggaccattgagtctacaattcatgtggttacaaggata
tctggaaaaggaaatcaagctgcttcttga

DBGET integrated database retrieval system