KEGG   Gallus gallus (chicken): 421249Help
Entry
421249            CDS       T01006                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     421249 (ABHD12)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   421249 (ABHD12)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   421249 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 381 aa AA seqDB search
MRKRNESVTVEHERAAAAPAPLDKGCSLRHSLRLPAADTGMKRPLGRRHGLWFRLRRLII
WLLGVYIAIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVT
IGVWHTVPAALWKNARGKDQLWFEDALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLG
YHVVTFDYRGWGDSVGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVR
RLCERETPPEALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDEN
VKYISCSLLILHAEDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYR
SPELPRILREFLGIPEHEHHH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcgcaacgagtcggtcacggtggagcatgagcgcgccgccgccgcgcccgcg
cctctcgacaagggctgcagcctgaggcacagcctgcgtctgcccgccgccgacacgggc
atgaagcgaccgctcggcaggcgacatgggttatggttccgattgcggaggctgataatc
tggctgctgggagtgtacatagccattccatttctagtgaaactttgccctgctattcag
gcgaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaaagacca
caagatcagggcttaaaccacacctgtaattattaccttcagccagaggaggatgtaacc
attggagtctggcatacggtccctgcagccttgtggaagaatgcccgagggaaggaccag
ctgtggtttgaagatgctttgggttccagccatcctgtgatcctctacttgcacggcaat
gcaggaacaagaggaggggatcaccgtgtggagctttataaggtcctcagctcccttggg
taccacgtggtcacatttgattatcgaggctggggtgattcagtaggcagcccatcagag
aggggaatgacctacgatgcccttcatgtctttgactggataaaagcaagaagtggagac
aaccctgtctatatctggggacactccttgggcacaggggttgcaacaaacctggtgagg
cgcctttgtgagagagaaacaccccctgaagccctgatactggaatctccattcaccaac
atacgggaggaagcacgaagccatcccttttctgtgatatacagatacttcccagggttt
gactggttcttccttgaccccatcacgacaagtgggattaaatttgcaaatgatgagaat
gtgaagtacatctcctgttccctgctcatccttcatgctgaggatgacccggtggtaccg
tttcacctgggaaagaagctttacaacattgctgcgacatcacggagtttccgagactac
aaggtgcagtttgtcccgttccacacagacctcggctatcggcacaagtacatctacagg
agtccagagctacctcgaatactgcgggaattcctgggaatacctgaacatgagcatcat
cactga

DBGET integrated database retrieval system