KEGG   Gallus gallus (chicken): 421347Help
Entry
421347            CDS       T01006                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gga  Gallus gallus (chicken)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    421347 (BPNT1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     421347 (BPNT1)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    421347 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 307 aa AA seqDB search
MASPTLLMRVVASAYSVAEKAATIVRKVMAGGDLGIVEKSGANDLQTKADRLVQMSICAS
LTRKFPKATIIGEEELPPEEVNEELIEDGYCEEILKKSCPAQYTGIKEEELVIWVDPLDG
TKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYEAGADAVLGRTIWGVLGIGAFGFQ
LTEVPAGKHIIVTTRSHGSTLVNDCIGALNPDSVIRVGGAGNKIIQLIEGKASAYVFASP
GCKKWDTCAPEAILHAVGGKITDIHGNSFQYNKEVKHMNSAGVLATLRNYDYYASRIPNT
VKQSLVP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccaactctgctcatgcgtgtcgtcgcctccgcgtattctgttgcagaaaaa
gctgcaacaattgttagaaaagttatggctggaggagatctggggatagtggagaagagt
ggagccaatgacttgcagaccaaagctgaccgactggtacaaatgagcatttgtgcttca
ctgacacggaagtttcccaaagcaacaatcataggagaagaagaactacctcctgaagaa
gtaaatgaggaattaattgaagatggctactgtgaagaaatactaaagaaatcttgtcct
gctcagtacacaggaattaaagaggaagagcttgtgatatgggttgatcctttggatggc
accaaagagtacactgaaggtctccttgaccatgtcactgtcctcattgggattgcttat
ggaggcaaagcaatagcaggagttattaaccagccatattacaactatgaggcaggagct
gatgctgtactgggcaggacaatttggggagtcctgggcataggtgcttttggatttcag
ctcacagaagtaccagctgggaaacacatcattgttaccacccgttcgcatggcagtact
ctggtaaacgactgcatcggtgctttgaacccagacagcgttatcagagttggaggagca
ggaaacaagatcattcaactcatagaaggcaaagcatctgcttatgtatttgccagtcct
ggatgcaagaagtgggatacctgtgcacctgaagctattttacatgcagtgggaggcaag
ataactgatatccatggaaactcctttcagtataacaaagaagtaaaacacatgaattca
gctggggtccttgccactttgagaaattatgactattatgccagtcgtattcctaacaca
gttaaacaatctcttgtgccttaa

DBGET integrated database retrieval system