KEGG   Gallus gallus (chicken): 421418Help
Entry
421418            CDS       T01006                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gga  Gallus gallus (chicken)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    421418 (RBKS)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     421418 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
3
AA seq 304 aa AA seqDB search
MGTVQENQTTICFTTRLPRAGETILGQKFFIGFGGKGANQCVQSARLGAKTSLICKVGKD
SFGNDYVANLKKNGVSTAFVGQTADAVTGTASIIVNSEGQNVIVIVPGANLLLSSEDLKR
ASDIICKAKVAVCQLEITPAVSLEALKMARASGVKTLFNPAPALADLDPEFYTHSDIFCC
NETEAEILTGIPVGNLEDTEKVGRLLLERGCKLVIVTLGAEGCMMISVEEPIPKHVPAEK
VRAVDTTGAGDSFVGALAFYLAHYPELPVEEMVRKCNYIASVSVQASGTQSSYPYRKDLP
QDLF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgttcaggaaaaccagactactatatgctttaccacgagattgccaagagct
ggagaaactatcctcggacagaagtttttcattggttttggtgggaaaggagccaatcaa
tgtgtccagtctgctcggcttggggccaagacctctctgatctgcaaggttgggaaggat
tcctttggcaatgattatgttgcaaatttgaagaagaatggtgtttctacagcatttgta
ggtcagactgcagatgctgttactggaactgcttcaataattgtcaacagtgaaggtcag
aatgttattgtcatagttccaggagccaatctgcttttaagttctgaagacctgaagaga
gcttctgatattatctgtaaagccaaagtggctgtctgccagctagaaataacccctgct
gtttctcttgaagcgctgaaaatggcacgtgctagtggagtaaaaaccttatttaaccca
gctccagcccttgctgacctagatccagaattttatacccattctgacatcttctgctgc
aatgaaactgaggcagaaattttaacgggcatcccagttggcaaccttgaagatactgaa
aaggtgggacgcctgctgttagaaagagggtgtaagctcgtaattgttactcttggagca
gaaggctgcatgatgatatcagtagaagaacccattccaaagcacgttcctgctgagaag
gtcagggctgtggacactacgggagctggagacagttttgtgggagcactggccttctac
ctggctcactatcctgagctgcccgtggaggaaatggtcaggaagtgtaactacattgca
tcagtgagtgtccaggcatcagggacacaatcttcatatccttacaggaaggacttgcct
caggaccttttctaa

DBGET integrated database retrieval system