KEGG   Gallus gallus (chicken): 421466Help
Entry
421466            CDS       T01006                                 

Gene name
CYP1B1, CYPIB1
Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  
cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    421466 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    421466 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    421466 (CYP1B1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     421466 (CYP1B1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP1 family
   421466 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 543 aa AA seqDB search
MEAACNSMALERLGEALRGTPPLQSSLLLLLCLLAAVHLGKLLLQRRRWRRQGQRLAPPG
PFPWPLIGNAAQLGSAPHLSFARLASTYGAVFQLRLGRWPVVVLNGESAIRQALVRQGAA
FAGRPAFPSFRLVSGGRSLAFGGYSELWKLHRRAAHATVRAFSTGSPATRRLLERHLLGE
ARALVALLVRGSAGGAFLDPSRVLVVAVANVMSALCFGRRYSHGDGEFLRLVGRNEQFGR
AVGAGSLVDALPWLRRFPSPVRAAYRAFRDLNRDFYGFVRGKFLQHQRSLRPGAAPRDMM
DAFIRLQREQPRLQLEHVPATVTDIFGASQDTLSTALLWLLIFLIRYPKVQAKMQEEVDR
IVGRDRLPCAEDQPHLPYIVAFLYESMRFSSFVPVTIPHATTTNTFIMGYLIPKDTVIFV
NQWSVNHDPAKWSNPEDFDPTRFLDENGFINKDLTSSVMIFSMGKRRCIGEELSKVQLFL
FTSILVHQCHFTANPNEDPKMDYTYGLTIKPKPFTLNVTLRDTMELLDKAVQRLQAEKTG
NEN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcgtgcaacagcatggccctcgagaggctcggggaagccctgcgcggcacc
ccgcccctgcagagctccctgctgctcctcctgtgcctgctcgccgccgtgcacctgggc
aagctcctcctgcagcgacggcgttggcggcggcagggccagcgcctggcgccgccgggc
cccttcccgtggccgctgatcgggaacgcggcgcagctgggcagcgccccgcacctctcc
ttcgcgcgcctggccagcacgtacggcgccgtgttccagctgcgcctggggcgctggccc
gtggtggtgctgaacggcgagagcgccatccgccaggcgctcgtccgccagggggccgcc
ttcgccggccggccggccttcccctcgttccgtctggtgtcgggcgggcgcagcctggcc
ttcggcggctactcggagctctggaagctgcaccgccgcgcggcgcacgccacggtgcgc
gccttctccaccggcagcccggccacgcgccgcctgctggagcggcacctgctgggcgag
gcgcgggcgctggtggcgctgctggtgcggggcagcgcgggcggcgccttcctcgacccc
tcgcgcgtgctggtggtggcggtggccaacgtgatgagcgcgctctgcttcggccgccgc
tacagccacggcgacggcgagttcctgcgcctggtgggccgcaacgagcagttcgggcgc
gccgtgggcgccggcagcctggtggacgctctgccctggctgcggcgcttccccagcccc
gtgcgcgccgcctaccgcgccttccgcgacctcaaccgcgacttctacggcttcgtccgc
ggcaagttcctgcagcaccagcgcagcctgcgcccgggggcggccccccgcgacatgatg
gacgccttcatccgcctgcagcgcgagcagccgcggctgcagctcgagcacgtgcccgcc
accgtcaccgacatcttcggcgccagccaggacacgctctccacggcgctgctctggctc
ctcatcttcctcatcaggtatccaaaagtgcaggctaaaatgcaagaagaagtggatagg
atcgttgggagagaccgcctaccctgtgctgaggatcagcctcacttgccctacatcgtg
gctttcctgtacgaatccatgcgtttcagcagctttgtgcctgttaccatcccacacgcc
accacgaccaacaccttcatcatgggctacctcattcccaaggacaccgtgatatttgtc
aatcagtggtcagtgaatcacgatccagctaaatggtccaacccagaggatttcgatcca
acaagattcctggatgagaacggcttcatcaataaagatctcaccagtagtgtgatgatt
ttctccatggggaagcggcggtgcattggagaggaattatccaaggtgcagctgtttctc
tttacctccattctcgtgcatcagtgccatttcactgctaatccaaatgaggatcctaaa
atggactatacttatgggttgaccatcaaacccaagccgtttaccttgaatgtcacactt
agagatactatggagttgcttgataaggctgtccaaagactgcaagcagagaaaacaggc
aacgaaaactag

DBGET integrated database retrieval system