KEGG   Gallus gallus (chicken): 421793Help
Entry
421793            CDS       T01006                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45 (EC:3.1.2.15)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     421793 (USP45)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   421793 (USP45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 223 aa AA seqDB search
MRVKDPSRANPEKTKRSKRPNRPQDEDSSDDIAVSFSLGLTCQHVSQAVDVHHVKRAVAQ
SIWSICSECLKERRMSDGEPVAPSDIWLCLKCGSQGCSKNSEGQHSLKHFQTARTEPHCI
VISLSTWIIWCYECDEELSTHCNKKALAQIVDFLQKHGSRAEPSSSKIIRLRDESSETSE
ILKGKSSGNGTSVPVKGINNLGNTCFFNAVMQVRWNAHTVFSL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagatccatcaagagctaaccctgagaaaacgaagagaagcaaaaggcct
aacaggccacaggatgaagactcttcggacgatattgcagtgtcattttctttaggctta
acctgccagcatgtgagccaagcagtggatgtacatcatgtgaagagagcagtagctcag
agcatttggtcaatatgttcagagtgtctgaaggaaaggcggatgagtgatggtgagcct
gtggcaccttcagacatatggctgtgtctcaagtgtggctctcagggatgtagtaagaac
tcagaaggacagcattctctaaaacacttccaaacagcacgcacggaacctcattgcatt
gttatcagtctcagtacatggatcatttggtgttatgaatgtgatgaagagctgtcaaca
cattgcaacaaaaaggctttggctcagatagttgacttccttcagaagcatggttccaga
gctgaaccaagttcatcaaaaatcatacgactccgtgatgaaagcagtgaaacaagtgaa
attctgaaagggaaaagttctggtaatggtacatcagttccagttaaaggaataaataat
ttaggaaatacgtgcttttttaatgctgtcatgcaggtaagatggaatgctcatacagtt
ttctctttatag

DBGET integrated database retrieval system