KEGG   Gallus gallus (chicken): 421849Help
Entry
421849            CDS       T01006                                 

Gene name
TTK
Definition
(RefSeq) TTK protein kinase
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    421849 (TTK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     421849 (TTK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: Other
  TTK family
   421849 (TTK)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     421849 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH FTA2 Kdo RIO1 Mad3_BUB1_I_2 Tubulin Mad3_BUB1_I
Motif
Other DBs
NCBI-GeneID: 421849
NCBI-ProteinID: XP_015140212
CGNC: 11840
Ensembl: ENSGALG00000015874
UniProt: E1BQR2
Position
3
AA seq 880 aa AA seqDB search
MEEEEDLSERGLPRIASIMSRVRDLKNKYRNEDNITDELNCTKISADTTDNSGTVNRIMM
TTNNPEDWLCFLLRLEKKGIPQMDLSILNRLIGRYSQAVTALPAEKHSEDENYARILVRF
AELKALQDPEEARDQFHLARLNCKKFAFVHVAFAQFELSQGNVKKCRQLLQKAVECSAVP
LEMLETALQNLNSQKKQLLSDEEKENFAVSSVQESGLQSIVGNQRNIKRNDSTENSSAVA
KHLLGEEKSQDHDAIVNFHNPLRPLNKSNQACPFGRVPVKLVTDFDDVVQKTDVPLTASV
MKRQVSSSKCTALIPPFPLSEPKPSENDSCDPADSKLLQENSVQLQMLDENSLETATNST
VTLKNKIDTSLVMKREENKLQYQELKIPEPRSMESQQQQSSSAESYRKQFDQIKLNCVNS
RKKWPSQEVMQQNCYREGKRSSLEQSAHPLSRRLSPPDAVSKKNELLYVCGTPSSTCTDY
MECFRTPIVRNNFSPGYQISTPYSQLPYFLPHTPATTFQNQMGLQVSGSIPSNECIAVKG
RIYTILKQIGSGGSSKVFQVLNEKKQLYAVKYVNLEEADQQTVESYKNEIAHLSKLQEHS
DKIIRLYSYEITDQHIYMVMECGNIDLNSWLKKKRNIDPLERKSYWKNMLEAVHTIHEHG
IVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVTSIVKDSQVGTMNYMPPEAIQDMSSSY
GENGKSQSKISPKSDVWSLGCILYCMTYGRTPFQHITNTRKKLYAIVDPHYEIEFPDIAE
KDLQDVLKRCLVRNPKQRISVSELLVHPYVQIQTQCQTGVANAKGATEEVKRILGQLVGL
NSPNSISRAARTLYEQCNSGKSLDVSAFAKSGSQKSWTAK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggaggatctaagtgaaagaggattgccacgaattgcttcaatcatgagt
agagttagagacttgaaaaacaaatacaggaatgaagacaatatcacagatgaactgaac
tgtactaaaatatcagctgatacaacagataactctggaactgttaatcgaataatgatg
acaacaaataatccagaagattggctgtgttttttgcttcggctggagaaaaagggtatt
cctcagatggaccttagtatactgaataggctcattggtcgctacagtcaagcggtaact
gcattacctgcagaaaagcatagtgaagatgagaactatgctcgcatccttgtgagattt
gcagagctgaaagctcttcaagatccagaggaggcacgagaccaattccatctggccaga
ctgaactgcaagaaatttgcttttgtgcatgtggcttttgcacagtttgagctgtcacaa
ggaaatgtgaagaagtgtagacagctccttcagaaagctgtggagtgctctgctgttcca
ctggaaatgttagaaactgctctacaaaacttgaattcacaaaaaaaacagttgctttca
gatgaggaaaaggagaactttgcagtatcaagtgtacaggagtctggacttcagagcata
gttggaaatcagagaaatataaaaaggaatgattctactgaaaattcttctgctgttgct
aaacatcttcttggggaagagaaatcacaagaccatgatgctatagttaacttccacaat
ccattaagaccactaaacaaatctaaccaggcctgcccttttgggagggttcctgttaaa
ctagtaactgattttgatgatgtggtgcagaagacggatgtccctcttacagctagcgtt
atgaaaaggcaagtatctagctccaaatgtacagccttgattccaccctttccactctct
gaaccaaaacctagtgagaatgattcgtgtgacccggcagactcaaagttattacaagaa
aattctgtgcagctgcagatgttggatgagaacagcttagaaacagctaccaattcaact
gtcactctgaaaaacaaaatagatacaagtcttgtgatgaaaagagaagaaaataaactc
caatatcaagagctgaagataccagagccaaggagcatggaaagtcaacagcagcaatcc
agttctgctgaaagctatagaaagcaatttgatcagataaaactgaactgtgttaactcc
agaaagaaatggccaagtcaagaagtgatgcagcaaaactgctatagagagggaaagcgg
tcaagtcttgagcaatctgctcatcccctttcaagaaggctatcaccaccagatgctgtt
tcgaagaaaaatgagctgttgtatgtttgtggaacaccaagctctacgtgtacagattat
atggagtgtttcagaacaccaattgtaaggaacaacttttcaccagggtatcaaatttct
actccctacagtcagctaccatattttctaccgcatactccagcaactacatttcaaaat
caaatgggcttgcaggtttcaggttctataccttcaaatgaatgcattgctgttaaagga
agaatttatacaatattaaagcaaataggtagtggaggctcaagcaaggtgtttcaagta
ctgaatgaaaagaagcagctgtatgcggtcaagtatgtgaatctagaagaagctgatcag
cagactgttgaaagctataagaatgaaattgctcatttgagtaaactacaagagcatagt
gataagataatccgtctttatagctatgaaattactgatcagcatatctacatggtaatg
gagtgtggaaacattgatctcaatagctggctgaaaaagaaaaggaatattgatccattg
gaacggaagagctattggaaaaatatgttggaagctgttcacacaatccatgaacacggc
attgtccacagtgatctgaaaccagcaaactttctgatagttgacggaatgttaaaactg
attgactttggcattgcaaaccaaatgcagccagatgtgacgagcatcgttaaagattca
caggttggcacaatgaattatatgccacctgaagcaatacaagatatgtcgtcttcctat
ggagaaaatgggaaatcacaatctaagataagtccaaaaagtgatgtgtggtcgttggga
tgcattttatattgtatgacgtatgggaggactccatttcaacatataacgaatacacgt
aaaaaactgtatgctatcgttgatcctcattatgaaatagaatttccagatattgccgag
aaagatcttcaagatgtgctaaagcgctgtttagtaagaaatcctaaacaaagaatatca
gtttcagagttgctggtacatccctatgttcaaattcaaacccaatgccaaacaggtgtt
gcaaatgcaaaaggagcaacagaggaagtaaagcgtatccttggccaacttgttggctta
aattctcccaactctatttccagagctgctaggactttatatgaacagtgcaacagtggt
aaaagtctcgatgtatcagcatttgccaaatctgggagtcaaaaatcatggacagcaaag
taa

DBGET integrated database retrieval system