KEGG   Gallus gallus (chicken): 421918Help
Entry
421918            CDS       T01006                                 

Gene name
ADI1, Fe-ARD, MTCBP-1, Ni-ARD
Definition
acireductone dioxygenase 1 (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gga  Gallus gallus (chicken)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gga00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
3
AA seq 180 aa AA seqDB search
MVEAWYMDESQEDQRAPHRLQPNRAVSLEQLRRLGVAYRRLDADNYETDPRLKEIREAEN
YSWMDIVTIHKDKLPNYEEKIKTFYEEHLHLDDEIRYILDGSGYFDVRDKDDKWIRISME
KGDMITLPAGIYHRFTLDENNYVKAMRLFVGEPVWTAYNRPADDFPARKQYMKFLAEEAQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcctggtacatggacgagtcccaggaggaccagcgggctccccacaggctg
cagcctaaccgcgccgtcagcctggagcagctgcgccgcctcggtgtcgcctaccgcaga
ttggatgctgataactatgagactgacccacgtctgaaagagattcgggaagcagaaaat
tattcttggatggatatagtaactatacataaagacaagctgccaaattatgaagaaaag
ataaaaacattttatgaagagcatttacacctagatgatgaaattcgttacatcttagat
ggatctggctattttgatgttcgggacaaggatgacaaatggatccggatttccatggag
aaaggagacatgataaccctccctgctggcatatatcaccgatttacactggatgagaat
aactacgtgaaagcaatgaggctatttgttggagaaccagtctggacagcatacaacagg
ccagcggatgattttcctgctcggaaacagtatatgaagtttttggctgaagaagcacag
taa

DBGET integrated database retrieval system