KEGG   Gallus gallus (chicken): 421918Help
Entry
421918            CDS       T01006                                 

Gene name
ADI1, Fe-ARD, MTCBP-1, Ni-ARD
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00270  Cysteine and methionine metabolism
gga01100  Metabolic pathways
Module
gga_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    421918 (ADI1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     421918 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     421918 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_8 Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 421918
NCBI-ProteinID: NP_001026260
CGNC: 66417
Ensembl: ENSGALG00000025796
UniProt: Q5ZL43
Position
3
AA seq 180 aa AA seqDB search
MVEAWYMDESQEDQRAPHRLQPNRAVSLEQLRRLGVAYRRLDADNYETDPRLKEIREAEN
YSWMDIVTIHKDKLPNYEEKIKTFYEEHLHLDDEIRYILDGSGYFDVRDKDDKWIRISME
KGDMITLPAGIYHRFTLDENNYVKAMRLFVGEPVWTAYNRPADDFPARKQYMKFLAEEAQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcctggtacatggacgagtcccaggaggaccagcgggctccccacaggctg
cagcctaaccgcgccgtcagcctggagcagctgcgccgcctcggtgtcgcctaccgcaga
ttggatgctgataactatgagactgacccacgtctgaaagagattcgggaagcagaaaat
tattcttggatggatatagtaactatacataaagacaagctgccaaattatgaagaaaag
ataaaaacattttatgaagagcatttacacctagatgatgaaattcgttacatcttagat
ggatctggctattttgatgttcgggacaaggatgacaaatggatccggatttccatggag
aaaggagacatgataaccctccctgctggcatatatcaccgatttacactggatgagaat
aactacgtgaaagcaatgaggctatttgttggagaaccagtctggacagcatacaacagg
ccagcggatgattttcctgctcggaaacagtatatgaagtttttggctgaagaagcacag
taa

DBGET integrated database retrieval system