KEGG   Gallus gallus (chicken): 421934Help
Entry
421934            CDS       T01006                                 

Gene name
KLF11
Definition
(RefSeq) Kruppel like factor 11
  KO
K09209  
krueppel-like factor 10/11
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    421934 (KLF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 530 aa AA seqDB search
MHGSGSPCPEMGDAAAVDIVDIYESIRERQRHDSERSTCSTLEQNDIEAVEALVCMSSWG
QRLQKGDILKIRPLTPFSDSGDFTMHAEAASELPKDCLSTLCMTPPHSPDLVEMSAAVLL
PSQVTYSKPRTVMANTAACLLTSTTDATPAAKPSVLSVERQCEQRADASAPQPCRAMATS
VIRHTGDSSAYHHGAAVREKAKAASGCGTSGDRRGAEGRRRPGLPQDACAADAFISKASP
VPQPCAADCSDVVHSKGQLPVRPVSPQAHLPKSCEDDLQRRATPVTPVPVSSPQVLCQMI
PLNGQSGVINAYVKPSAPAVSAPMKPILPQAAPLSQPVLVGSSVPQGAVMLVLPQTAVAP
TPQCPQTVMTVGNTKLLPLAPAPMFIASGQSCTPQMDFSRRRNYVCNFPGCKKTYFKSSH
LKAHLRTHTGEKPFSCNWEGCDKKFARSDELSRHRRTHTGEKKFACPVCERRFMRSDHLT
KHTRRHMATKKVPSWQTEVGKLNRMATAEKPKGSGALSMLIPVPSPVCQG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcacggctcgggttcgccctgcccggagatgggagatgcggccgcggttgacattgtg
gatatctacgagtccatccgggagcggcagcgccacgacagcgagcgctcgacctgcagc
accctggagcagaacgacatcgaggccgtggaggcgcttgtttgtatgagctcctggggg
caaagactgcagaaaggtgacatattaaagataaggcctctcacgcccttctcggattct
ggagatttcacaatgcacgctgaggccgcttctgaattaccgaaggattgtttatccaca
ctgtgcatgacccctccgcacagccccgacttggtggagatgtctgccgccgtgctgctc
ccctcgcaggtcacctactccaagcccaggaccgtcatggcaaacacagctgcctgcttg
ctcacgtccaccaccgacgcgactcccgcggccaagccgtccgttctgagcgtggagagg
cagtgtgagcagagggcggacgcctctgcccctcagccctgccgggccatggcgacgagc
gtcatacggcacacgggcgacagctctgcttaccaccacggtgctgccgtgcgagagaaa
gcaaaggcagcttcgggctgcggcacttctggggaccggcgtggagcagagggccgaagg
cgtcccggcctgccgcaggacgcgtgtgctgccgatgctttcattagcaaagcctctccg
gtaccccagccgtgcgctgctgactgcagcgatgtggtgcatagcaagggacagcttcca
gtccgacctgtttcgccacaggcccacttaccaaagagctgcgaggatgacttgcaaaga
agagctaccccggtgacgcccgtccctgtgtcaagcccccaggttctctgtcaaatgatc
cccttgaatggacaaagcggtgtgattaatgcctacgtcaaaccttcagctccggccgtc
tcagctccgatgaaacctatcttaccgcaggcggctccgctttctcagcctgtgctcgtg
gggtcttctgtgcctcagggggccgtcatgttggttcttccgcagaccgctgtggcaccg
acgccgcagtgcccgcagacagtaatgactgttgggaacaccaagctcctgcccctcgct
cctgcccccatgttcatcgcttctggtcaaagctgcaccccccagatggacttctcgaga
cggaggaattacgtttgcaacttccccgggtgcaagaaaacctatttcaagagctcccac
ctcaaagcccaccttcgtacccacactggagaaaagcccttcagctgcaactgggaaggc
tgtgacaagaagtttgcccgctcagacgaactgtcacgccaccgccgaactcacacgggg
gagaagaagtttgcctgccccgtgtgcgagcgccgcttcatgcgcagcgatcacttgacg
aagcacacccgccgccacatggccaccaagaaggtccccagctggcagacagaggtgggc
aaactgaacagaatggccacagcggagaagccgaaaggcagcggtgctctgagcatgctc
atccccgtgccatcgcccgtctgtcagggctag

DBGET integrated database retrieval system