KEGG   Gallus gallus (chicken): 422016Help
Entry
422016            CDS       T01006                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     422016 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 1510 aa AA seqDB search
MSGLGDSSTDPANPDSRKRKGSPCDTAQSNEKRRREQENKYLEELAELLSANIGDIDTLS
VKPDKCKILKKTVDQIQQMKRLEQEKAADDEVQKSDISSSSQGVIEKESLGPLLLEALDG
FFFVVNREGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHTEFVKNLLPKSLVNGVP
WPQEATRRNSHTFSCRMLIRPPDEPGTENQEARQRYEVMQCFTVSQPKSFKEEGEDFQSC
LICIARRLPRPAAVTPSESFVTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTVLSAHTKCKLCYPSSPEVQPFIMGIH
IIDRDHGMLSPQENTNSAMALPRVSPSLNPNISPGQGMALPPSIPPSNGSMLATPGNQQP
GAGLHSSNSSTSQTSFGCSPGNQIGANVALSQGQAGPPNSNHNLNLSSSPMNSPGITPPQ
FMSPRHRVSPGLVPRPRGPSNPFSPTMPTMHSPVGMANSGGGGNGGGGGGGSRSFPTAPI
NSLQGLSEGASTPVGYSTPPPVLRQLGSQSSPGRLGMQPMKAESKDSKEIASILSEMIQS
DGSAGDGKPLDSGVLHASERLTEGESKCSQATSHKLVQLLASTAEQQLRHADADTSCKDS
LACAGTTGTLGASNPPSSTCPSSHSSLTERHKILHRLLQEGSPSDITTLAMEHDKKDNVP
NPATTPTAPSQLPGTQDIKLESDAMKKKDVKDHQLLRYLLDKDEKELAAAPALSLDDVKV
KVEKTEQMEPCNTTPVPLAKPPAAEEVKLESQGQFAAELEQLDQLLPSLEKAAQLPGLCG
PERSESGVAVKSEMLAAPLQPSTAPRAPTGLNPLSSGQGMQAARAPFEFCDPLEPAQLRP
VAFPTTNGSSPRPRAPAEQGRGTVPGPNPFPPDTGMSELEMGVPDHQFGQPGMGEQMPWT
DNSMAPMNRGTLSKPEDPCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDETELA
ELDRALGIDKLVQGGGLEALTERFQPQQATPPLMMEQKPGMYPQPYSSASPTTNLPAAFP
GMVRQKPSFGPMPVQVPPPRGAFPTTMAMQPRQALSRPPTAPNQLRLQLQQRLQGQQQLI
HQNRQAILNQFAANSPVGINMRAGMQQQMTPQPPLNAQMLAQRQRELYSQQHRQRQLMQQ
RAILMRQQSFGNNLPPSAGLPVQMGAARLPQAPPQQFPYPPNYGTSPGNPPTSTSPFSQL
ASSPEAALANRGGMVTRGMMGSVGGQFGTGMTPQMQQNIFQYSGSGMGQQNEPTFAPSLS
PSSPLMSPQLPPSQSPMLQPAPPAPGYQSPDMKTWQQGAMGNSNVFSQTGQTQPAPAQQG
MYNNMSITVSMAGGNTNVQNMNPMAGQMQMNSLQMPGMNSMCSEQVNDPALRPTGLYCNQ
LSSTDLLKTEADGAQQVQQVQVFADVQCTVNLVGDPYLNPPAPLGAPKAAAVPPTPQGQQ
KSLLQQLLTE
NT seq 4533 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagctcgacagaccccgccaaccccgactcgcggaagaggaag
ggctcgccctgcgatacagcccagagcaatgaaaagcggcggcgggagcaagagaacaaa
tatttggaggagctggcagagctgctgtctgcaaacattggggacatcgacaccctgagt
gtcaaaccagacaaatgcaagatcctgaagaagacggttgatcagatccagcaaatgaag
aggttggagcaagagaaagcagctgatgatgaagtccagaagtctgacatctcatccagc
agccaaggagtgattgagaaggagtcgttgggacctcttctgctggaggcattggatggc
ttcttcttcgtcgtgaatcgcgaagggaggatcgtcttcgtctctgagaacgtcaccagc
tacctggggtacaaccaggaggagctcatgaacaccagtgtctacagcatcctgcacgtg
ggggaccacaccgagtttgtcaagaacttgttgcccaagtctctagtgaatggagttccc
tggcctcaggaagcgacccgacgcaacagccacacgttcagctgcaggatgctgatccgg
ccgcccgacgagcccggcactgagaaccaggaggctcgacagcgctacgaggtgatgcag
tgcttcaccgtttcccagcccaagtcgttcaaggaggaaggagaagatttccaatcctgt
ctgatatgcattgcgagaaggttacctcgaccagcagccgtcaccccttccgaatccttc
gtgaccaagcaagacaccacaggtaaaatcatctccatcgacaccagctccctgagagct
gccggcaggacgggttgggaagatttagtgaggaaatgcatctatgctttcttccagcct
cagggcagagagccatcttacgccaagcagctgtttcaagaagtgatgacacgtggcacg
gccttcagcccatcttatcgattcaccctgagcgacgggacggtgctcagcgctcacacc
aagtgcaagctctgctacccctccagcccagaagtgcaacccttcatcatgggcatccac
atcatcgacagggatcacggcatgctgtccccccaggagaacactaattcggccatggcc
cttccgcgggtcagcccctctctgaaccccaacatctcccccgggcaaggcatggccctg
ccgccctccatccctccctccaacggcagcatgctggccacccctggcaaccagcagccc
ggtgccggcctccacagcagcaactccagcaccagccaaacgagcttcggctgttctcct
gggaaccagataggagccaacgttgccttaagccagggacaagccggtcccccgaacagt
aaccacaatttaaacctcagtagctcccccatgaacagcccagggatcaccccgccgcaa
ttcatgtctcctaggcaccgggtcagcccaggactggtcccccggccccggggacccagc
aatcccttctcccccaccatgcccaccatgcactcccccgtgggcatggctaacagcggc
gggggcggcaacggtggcggtggcggcggtggctccaggtcctttcccaccgcccccata
aactctttgcaggggcttagcgaaggtgccagcacgccggtgggctactccacgccaccc
cctgtgctgagacagctgggctcccagagctcgcctggccgccttggcatgcagcccatg
aaggcggagtccaaggacagcaaggagatcgcctccatcctgagcgagatgatccagtcc
gatggcagtgcaggtgacggcaagccgctggactcgggtgtgctgcatgccagcgagagg
ctcacagagggggagagcaagtgctcccaagccaccagccacaagctggtccagctgctg
gccagcacggccgagcagcagcttcggcacgcggacgcggacacgagctgcaaggattcg
ttggcctgcgcgggcaccacgggcacgctgggtgccagcaacccgccgagcagcacctgt
ccctcctcccatagctcgctgaccgagcggcacaagattttgcatagactccttcaggag
ggcagcccttctgacatcaccaccttggccatggagcacgacaaaaaggataacgtcccc
aaccccgccaccaccccgacggccccgagccagctgccgggcacccaggacatcaagctg
gagtcggatgcgatgaaaaagaaggatgtcaaggatcaccagctcctgcgctatctgctt
gataaggacgagaaggagctcgctgccgccccagccctcagcctggatgacgtgaaggtg
aaggtggagaagacggagcagatggagccctgcaacaccaccccagtgccgctggccaag
ccaccggccgcagaggaggtcaagctggagtcacaaggccagtttgctgctgaactggag
cagctggaccagctcctgccatcactggagaaagctgcccagctaccgggcttgtgcggg
ccagagaggagtgagagcggcgtggctgtcaaatccgaaatgctggcagcccccctgcag
cccagcactgcccccagagcccccaccggcctcaaccctctcagcagcgggcagggcatg
caggcagctcgagccccctttgagttctgcgacccactggagccagctcagctcaggcca
gttgctttccccacaaccaacggcagcagcccgcggccccgagcgccggccgagcagggc
aggggcactgtgccaggaccaaaccccttcccacctgacacagggatgtcagagctggag
atgggggtgccagatcaccagtttgggcagccgggcatgggcgagcagatgccatggaca
gataacagcatggcacccatgaaccgaggcacgctgagtaaacctgaagacccctgcatc
acctcgcagctggacgagctcctgtgtcctcccaccaccccggagggccgcaacgatgag
aaggcgctgctggagcagctcgtgtccttcctgagtggcaaggacgagacggagctggcc
gagctggaccgagccctcggcatcgacaaactggtgcagggcggcgggctggaagccctg
acggagcggttccagccccagcaagccacccctccgctgatgatggagcagaagcccggc
atgtacccccagccttactcctctgcatctcccaccaccaacctccctgccgccttcccc
ggcatggtccgccagaagccgtccttcggtcccatgccggtgcaggtcccgccgccgcgc
ggtgccttccccaccaccatggccatgcagccccggcaggcgctcagccgaccccccacg
gctcccaaccagctgcgacttcagctgcagcagcggctgcagggccagcagcagctgatc
catcagaaccggcaggcgatcctcaaccagtttgcagccaactcccctgtgggcatcaac
atgagggcaggcatgcagcagcagatgaccccgcagcctcccctcaacgcccagatgctg
gcccagcgccaacgcgagctctacagccagcagcaccggcagcggcagctcatgcagcag
cgagccatcctcatgcgccagcagagcttcggcaacaacctcccaccctcagccgggctc
ccggtgcaaatgggggccgcccgcctcccccaggctcccccacagcagttcccttatccc
cccaactacggtacgagccccgggaaccctcccacctccaccagccccttctcgcagctg
gcttccagccctgaggccgcgttggccaaccgcggcggcatggtgaccagggggatgatg
ggcagcgtcggagggcagtttggcaccgggatgacgccgcagatgcagcagaacatcttt
cagtattccggatcaggcatgggtcagcagaatgagcccaccttcgccccgtcgctcagc
cccagcagtcccctgatgtcaccgcagctccctccatcacaaagcccaatgctgcagccg
gcacctcctgcaccgggctatcagtcacccgacatgaagacctggcagcagggagccatg
gggaacagcaacgtattcagccaaacggggcagacccagccagcaccggcccagcaggga
atgtacaacaacatgagcatcaccgtctctatggcaggaggaaacaccaacgtccagaac
atgaatcccatggcgggacagatgcagatgaactcactgcagatgcctgggatgaactcc
atgtgctcggagcaggtaaacgacccggcgctgagacccacgggcctttactgcaaccag
ctttcctccactgaccttttgaaaacagaagcagatggggcgcagcaggtacagcaggtt
caggtgtttgccgacgtgcagtgtacagtgaatctggtaggagatccctacctgaaccct
ccggctcccctgggcgccccgaaagccgccgcggtgccgccgaccccgcagggccaacag
aagagccttcttcagcagctactgactgaataa

DBGET integrated database retrieval system