KEGG   Gallus gallus (chicken): 422021Help
Entry
422021            CDS       T01006                                 

Gene name
ELP3
Definition
elongation protein 3 homolog (S. cerevisiae) (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     422021 (ELP3)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    422021 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 546 aa AA seqDB search
MGQKRKDLSHAELMMMTIADIIKQLIEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDII
AAVPPQHRKALVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFE
YSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDY
RDYFIRNLHDALSGHTSNNVAEAVKYSERSLTKCVGITIETRPDYCLKRHLSDMLSYGCT
RLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDTDQF
VEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARILALVPPWTR
VYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPYQIE
LIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSEESFRPELKGGVSIVRELHVYGSV
VPVSSRDPSKFQHQGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRNYYRKIGYELEGPY
MVKRLQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaagcggaaagatctcagccatgcagagctgatgatgatgacaatagctgac
atcataaaacagttaattgaggctcacgagcaaggaaaggatgtgaatctgaacaagctg
aaaaccaaaacctcagcaaagtatgggctctcggcacagccgcggttggttgacatcatc
gctgccgtcccaccacagcaccgcaaggcgctggtgccaaagctgaaggccaagcccata
aggacggctagtgggattgctgtcgtggctgtgatgtgcaaaccacacaggtgtccgcac
attaacttcacaggcaacatatgtgtatactgcccaggtggccctgattctgattttgaa
tattcaacgcagtcttacactggatatgagcctacatccatgagggccattcgggctcgg
tacgacccctatctccagacaagacatcgagtggaacagctgaagcagttgggtcacagc
gtggataaagtggagttcattgtgatgggtggaactttcatggccttgcctgaagactac
agggattacttcatccgaaaccttcacgatgcgctgtcgggtcacacctccaataacgta
gcagaggctgtcaagtattctgaacgaagcttgacaaaatgcgttgggataaccatagag
accagaccagattactgcctgaagcgccatttgagcgacatgctgtcctatggctgcacg
aggctggagattggagtgcagagtgtgtacgaggacgtggccagggacaccaacagaggt
cacaccgtgaaggctgtgtgcgagtcgttccacttagccaaggatgctggcttcaaagtg
gtggcacacatgatgcctgatttaccaaacatggggcttgaaagggacaccgaccaattt
gttgagttctttgagaacccagcttttcgccccgatggcatgaagctctacccaacgctg
gtgatccgcggcaccgggctgtacgagctctggaagactgggagatacaagagctacccc
cctagcactcttgttgatctcgtggccagaatcctggctctggtcccgccatggacgcgt
gtgtaccgtgttcagagagacatcccaatgccactggtgagctctggagtggagcatggg
aacctgagggagcttgccttggccaggatgaaagaccttgggacacagtgtcgtgatgta
aggacaagagaggttggaattcaagaaattcaccataaagtaagaccatatcagattgaa
ttaattagaagagattatgtggctaatggtggctgggagaccttcctctcctacgaagac
ccggagcaggacattctcgttggcctcttacgactgcgaaagtgctcagaggagtccttc
agacctgagctgaaagggggtgtttccattgtgcgagagctgcatgtgtatgggagtgtg
gtccctgtgagcagtcgggacccttccaaatttcagcaccagggatttggcatgctactc
atggaggaggcagaaagaatagccaaggaggagcacgggtcatggaaaattgctgtaatt
tcaggcgttggcacaaggaactactacaggaagataggctatgagctggaggggccgtac
atggtgaaaaggctgcagtga

DBGET integrated database retrieval system